Information

13.6: Integrine - Biologie

13.6: Integrine - Biologie


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Die Integrine wurden bisher als Rezeptoren für Fibronektin und Laminin eingeführt, aber es handelt sich um eine große Familie mit einer großen Vielfalt an Substraten. Beispielsweise zeigt die fokale Adhäsion (Abbildung (PageIndex{8})) einen an Kollagen gebundenen Integrinrezeptor. Wie bereits im vorigen Kapitel diskutiert, sind fokale Adhäsionen in der Regel vorübergehend und werden als Kontaktpunkte angesehen, wenn Fibroblasten oder andere wandernde Zellen auf einer mit ECM-Proteinen beschichteten Kulturschale oder Objektträger kriechen.

Neben Kollagen sind auch Fibronektin und Laminine potenzielle Bindungspartner für Integrine. Wie Tabelle 1 zeigt, sind Integrine aufgrund der Vielfalt der Untereinheiten und Kombinationen an einer Vielzahl von zellulären Prozessen beteiligt und können sowohl Zelloberflächenproteine ​​als auch ECM binden.

Tabelle 1: Integrinrezeptoren, ihre Liganden und Verteilung.
UntereinheitenLigandVerteilung
α1β1meist Kollagene, auch Lamininweit verbreitet
α2β1meist Kollagene, auch Lamininweit verbreitet
α4β1Fibronektin, VCAM-1hämatopoetische Zellen
α5β1FibronektinFibroblasten
α6β1lamininweit verbreitet
α6β4lamininEpithelzellen
αLβ2ICAM-1, ICAM-2T-Lymphozyten
αllbβ3Fibronektin, FibrinogenBlutplättchen

Bei dieser Vielfalt überrascht es nicht, dass nicht alle Integrine RGD-Sequenzen binden, obwohl dies die meisten tun. Beispielsweise bevorzugen α2β1-Integrine YYGDLR- oder FYFDLR-Sequenzen und αIIbβ3 bindet sowohl die RGD- als auch die KQAGDV-Sequenz stark. Es wurde gezeigt, dass die Integrin-Aktivierung Signalwege in Gang setzt, indem sie die fokale Adhäsionskinase (FAK) oder einige andere zentrale Kinasen einleitet, die Aktivitäten von der Zytoskelett-Umordnung bis zum Zellüberleben steuern.

Sowohl die α- als auch die β-Untereinheit sind Transmembranproteine, die die Membran nur einmal passieren. Evolutionär kommen sie nur in Metazoen-Arten vor, aber sie kommen auch in vor alle metazoische Arten. Alle Integrine außer einem, α6β4, verbinden sich über die zytoplasmatische Domäne der b-Untereinheit mit dem Aktin-Mikrofilament-Zytoskelett. Das α6β4-Integrin verbindet sich mit dem Zwischenfilament-Zytoskelett, teilweise weil die zytoplasmatische β4-Domäne sehr groß ist und sich weiter in das Zytoplasma erstreckt. Auf der extrazellulären Seite befindet sich eine Metallionen-Koordinationsstelle, die normalerweise von Mg . besetzt ist2+, die für die Ligandenbindung notwendig ist. Es gibt auch mehrere andere bivalente Ionenbindungsstellen. Der Rezeptor kann entweder in einem inaktiven (etwas zur Membran hin gebogenen) oder einem aktiven Zustand (aufgerichtet) gefunden werden. Im inaktiven Zustand bindet die a-Untereinheit die β-Untereinheit eng und verhindert so eine Wechselwirkung mit dem Zytoskelett. Wenn es sich jedoch um eine zytoplasmatische Domäne einer Untereinheit handelt, verdrängt sie die a-Untereinheit, was eine leichte Trennung der beiden Untereinheiten verursacht und zur Aktivierung des Rezeptors führt. Tatsächlich zeigen Integrine eine sogenannte „inside-out“-Signalgebung, bei der ein zelluläres Signal (zum Beispiel aus der Signalkaskade eines Wachstumsfaktors) zu Veränderungen der zytoplasmatischen Domäne führt und die Konformation der extrazellulären Domäne verschiebt in einen aktiven aufgerichteten Zustand, in dem es leichter an Liganden binden kann. Aus diesem Grund eignen sich Integrine so gut für fokale Adhäsionen und andere „in Bewegung“ Adhäsionen, die schnell haften und sich lösen müssen. Obwohl auch das Recycling von Rezeptoren stattfindet, ist das Ein- oder Ausschalten durch Inside-Out-Signale ein effektiver Mechanismus für eine schnelle Bewegung.

Wie man es von einer Aktin-verknüpften Struktur erwarten kann, sind fokale Adhäsionen und ihre in vivo Äquivalente sind vorübergehende, dynamische Berührungspunkte zwischen der Zelle und dem Substrat, über das sie kriecht. Es gibt jedoch viele Situationen, in denen eine Zelle nicht nur stationär ist, sondern auch fest mit ihrem Substrat verbunden sein muss, um sich für alle möglichen Stressoren zu rüsten, die ihre Entschlossenheit auf die Probe stellen. In diesen Fällen ist das Aktin-Zytoskelett für diese Aufgabe zu kurzlebig.


Forschungstätigkeit

Unsere Forschung zielt darauf ab zu verstehen, wie Zellen auf Veränderungen der mechanischen Eigenschaften ihrer Umgebung reagieren. Wir kombinieren Biochemie-, Molekularbiologie- und quantitative Biophysik-Ansätze, um die molekularen Mechanismen zu untersuchen, die die Kernstruktur und -funktion als Reaktion auf mechanischen Stress steuern. Aktuelle Projekte konzentrieren sich auf: Wie das Nukleoskelett die Genexpression in Gefäßzellen und in neuronalen Vorläuferzellen reguliert und wie die interzelluläre Übertragung mechanischer Signale das kollektive Verhalten innerhalb des Epithels reguliert.

Mitarbeiter

Christophe Guilluy, PhD (Gruppenleiter) [email protected]

J. Aureille, V. Buffière-Ribot, BE Harvey, C. Boyault, L. Pernet, T. Andersen, G. Bacola, M. Balland, S. Fraboulet, L. Van Landeghem, C. Guilluy . Die Deformation der Kernhülle steuert das Fortschreiten des Zellzyklus als Reaktion auf mechanische Kraft. EMBO-Repräsentanz. 2019

Guilluy C , Osborne L, Van Landeghem L, Superfine R, Garcia-mata R und Burridge K. Isolierte Kerne passen sich der Kraft an und zeigen einen Mechanotransduktionsweg innerhalb des Kerns. Nat Cell Biol. 2014 Mär 9. doi: 10.1038

Guilluy C , Swaminathan V, Garcia-Mata R, O’Brien ET, Superfine R, Burridge K. Die Rho GEFs LARG und GEF-H1 regulieren die mechanische Reaktion auf Krafteinwirkung auf Integrine. Nat Cell Biol. 2011 Jun13(6):722-7

Guilluy C , Burridge K. Nukleare Mechanotransduktion: Zwingt den Kern zu reagieren. Kern. 20156(1):19-22

Collins C, Guilluy C , Welch C, O’Brien ET, Hahn K, Superfine R, Burridge K, Tzima E. Lokalisierte Spannungskräfte auf PECAM-1 lösen eine globale Mechanotransduktionsreaktion über den Integrin-RhoA-Weg aus. Curr Biol. 2012 Nov. 2022(22):2087-94

Thompson WR, Guilluy C , Xie Z, Sen B, Brobst KE, Yen SS, Uzer G, Styner M, Case N, Burridge K, Rubin J. Mechanisch aktiviertes Fyn nutzt mTORC2 zur Regulierung von RhoA und Adipogenese in mesenchymalen Stammzellen. Stammzellen. 2013 Nov31(11):2528-37

Sandrine Fraboulet, PhD (Assoziierte Professorin)[email protected]

Ausgewählte Publikationen

V. Mercier, M. H. Laporte, O. Destaing, B. Blot, C.M. Bloin, K. Pernet-Gallay, C. Chatellard, Y. Saoudi, C. Albigez-Rizo, C. Lamaze, S. Fraboulet, A. Petiot, R. Sadoul. Das mit ALG-2 interagierende Protein-X (Alix) ist für die Clathrin-unabhängige Endozytose und Signalübertragung essentiell. Wissenschaftlicher Bericht. 2016 (6):26986

Chassefeyre, J. Martinez-Hernández, F. Bertaso, N. Bouquier, B. Blot, M. Laporte, S. Fraboulet, Y. Couté, A. Devoy, A. Isaacs, K. Pernet-Gallay, R. Sadoul, L. Fagni, Y. Goldberg. Regulation der postsynaptischen Funktion durch die Demenz-bezogene ESCRT-III-Untereinheit chmp2b. Zeitschrift für Neurowissenschaften. 2015 18 35 (7): 3155-73. Erratum in: J Neurosci. 2015 Mai 20 35 (20): 8035-7.

Chivet, F. Hemming, K. Pernet-Gallay, S. Fraboulet, R. Sadoul. Neue Rolle neuronaler Exosomen im Zentralnervensystem. Front Physiol. 2012 3:145.

Briese, B. Esmaeili, S. Fraboulet, E. C. Burt, S. Christodoulou, P. R. Towers, K. E. Davies, D. B. Sattel. Die Deletion von smn-1, dem Caenorhabditis elegans-Ortholog des spinalen Muskelatrophie-Gens, führt zu Bewegungsstörungen und verkürzter Lebensdauer. Hum Mol Genet. 2009 18(1):97-104.

A. L. Mahul-Mellier, F. Strappazzon, A. Petiot, C. Chatellard-Causse, S. Torch, B. Blot, K. Freeman, L. Kuhn, J. Garin, J. M. Verna, S. Fraboulet, R. Sadoul. Alix und ALG-2 sind am TNF-R1-induzierten Zelltod beteiligt. J. Biol. Chem.-Nr. 2008 283(50):34954-65.

Monika Elzbieta Dolega, PhD (Wissenschaftlicher Mitarbeiter) [email protected]

Ausgewählte Publikationen

Dolega ME, Delarue M, Ingremeau F, Prost J, Delon A, Cappello G. Zellähnliche Drucksensoren zeigen eine Zunahme der mechanischen Spannung in Richtung des Kerns mehrzelliger Sphäroide unter Kompression. Nat. Komm. 2017 Jan 278:14056. doi: 10.1038/ncomms14056.

Dolega ME, Abeille F, Picollet-D’hahan N, Gidrol X. Kontrollierte 3D-Kultur in Matrigel-Mikrokügelchen zur Analyse der klonalen Azinusentwicklung. Biomaterialien. 2015 Juni 52: 347-57. doi: 10.1016/j.biomaterials.2015.02.042. Epub 2015 3. März

Dolega ME, Wagh J, Gerbaud S, Kermarrec F, Alcaraz JP, Martin DK, Gidrol X, Picollet-D’hahan. Die einfache Herstellung von geschlossenen kreisförmigen Mikrokanälen auf dem Labortisch bietet eine 3D-begrenzte Struktur für das Wachstum von Prostataepithelzellen. Plus eins. 2014 Juni 199(6):e99416. doi: 10.1371/journal.pone.0099416. eCollection 2014.

Lydia Pernet, PhD (Ingenieurin) [email protected]

Aufgaben im Labor:

– Experimente in Biochemie, Molekular- und Zellbiologie
– Pflege der Zellkulturlinie
– Entwicklung von ATACseq-Experimenten

– Molekularbiologie -> qPCR
– Gesundheit und Sicherheit à Präventionsassistent und Ersthelfer am Arbeitsplatz

– Verantwortlich für die Pflege des Kulturraums
– Schülerbetreuung
– Einkaufsleiter


Entkopplung von Integrinadhäsion und -signalisierung: das βPS Die zytoplasmatische Domäne reicht aus, um die Genexpression im Drosophila Embryo

Integrin-Zelloberflächenrezeptoren sind ideal geeignet, um die Zelldifferenzierung und den Gewebeaufbau während der Embryogenese zu koordinieren, da sie sowohl Signalübertragung als auch Adhäsion vermitteln können. Wir zeigen, dass Integrine die Genexpression im sich entwickelnden Embryo regulieren, indem wir zwei Gene identifizieren, die für ihre normale Expression eine Integrinfunktion benötigenDrosophila Endodermale Zellen des Mitteldarms. Wir haben die relativen Rollen der Integrin-Adhäsion gegenüber der Signalgebung bei der Regulation dieser Integrin-Zielgene bestimmt. Wir stellen fest, dass keine Integrin-vermittelte Adhäsion zwischen den endodermalen Zellen und dem umgebenden viszeralen Mesoderm für die Integrin-Zielgenexpression erforderlich ist. Darüber hinaus kann ein chimäres Protein, dem die Integrin-Adhäsionsfunktion fehlt, aber die Fähigkeit zur Signalisierung beibehält, das endogene Integrin ersetzen und Integrin-Zielgene regulieren. Diese Chimäre besteht aus einer oligomeren extrazellulären Domäne, die an das Integrin β . fusioniert istPS Untereinheit der zytoplasmatischen Domäne eine Fusion einer monomeren extrazellulären Kontrolldomäne verändert die Integrin-Zielgenexpression nicht. Daher ist die Oligomerisierung der 47-Aminosäure βPS intrazelluläre Domäne reicht aus, um einen Signalweg zu initiieren, der die Genexpression im sich entwickelnden Embryo reguliert.


Veröffentlichungen

Campbell, H., Salvi, A., O’Brien II, E.T., Superfine, R., & DeMali, K. (2019). “PAK2 verbindet das Überleben der Zellen mit der Mechanotransduktion und dem Stoffwechsel.” Journal of Cell Biology 218(6): 1958-1971. PMC6548143

Liu, B., Hobson, C. M., Pimenta, F. M., Nelsen, E., Hsiao, J., O’Brien, E.T., Falvo, M.R., Hahn, K.M. und Superfine, R. (2019). “VIEW-MOD: eine vielseitige Beleuchtungs-Engine mit modularem optischem Design für die Fluoreszenzmikroskopie.” Optics Express 27(14): 19950-19972. NIHMS1053869

Marston DJ, Anderson, K. L., Swift, M. F., Rougie, M., Page, C., Hahn, K. M., Volkmann, N. und Hanein, D. (2019). Die hohe Rac1-Aktivität wird funktionell in zytosolische Strukturen mit einzigartiger nanoskaliger Zytoskelettarchitektur übersetzt. PNAS. 116(4):1267-72. Epub 2019 10. Januar. PMC6347697. PDF

Beicker K, O’Brien III, E.T., Falvo, M.R. und Superfine, R. (2018). Vertikale Light Sheet Enhanced Side View Imaging für AFM-Zellmechanikstudien. Wissenschaftliche Berichte. 8(1504). 8(1): 1504. PMC5784156. PDF

Carpenter J, Lynch, S. E., Cribb, J. A., Kylstra, S., Hill, D. B., & Superfine, R. (2018). Pufferdrainagen und Schleim wird in einem geneigten Mucus-Clearance-Assay nach oben transportiert. American Journal of Physiology – Molekulare Physiologie der Lungenzellen. Epub 2018 Sept. 13. DOI 10.1152/ajplung.00274.2018.PMC6295511 PDF

Dagliyan O, Krokhotin, A., Ozkan-Dagliyan, I., Deiters, A., Der, C.J., Hahn, K.M, Dokholyan, N.V. (2018). Computergestütztes Design von chemogenetischen und optogenetischen Spaltproteinen. Naturkommunikation. 9(1):4042. PMC6168510. PDF

Eicher, JE, Kapustina, M., Falvo, M. und Jacobson, K. Bestimmung der 3D-Amöboide-Migrationskraft durch Verwendung von aktivierten oberflächengebundenen Pfosten. biophysical Journal San Francisco, CA 2018. p. 16A-7A. Zusammenfassung PDF

Judith RM, Lanham, B., Falvo, M. R., & Superfine, R. (2018). Mikrofluidische Viskosimetrie mit magnetisch betätigten Mikropfosten-Arrays. Plus eins. 13(7):e0200345. PMC6049921 PDF

Ma X, Dagliyan, O., Hahn, K. M. und Danuser, G., (2018). Profiling zellulärer Morphodynamik durch raumzeitliche Spektrumzerlegung. PLoS-Computerbiologie. 14(8):e1006321. Epub 2018 Aug. doi. 10.1371/journal.pcbi.1006321. PMC6091976. PDF

Nelsen E, Hobson, C., Hsiao, J., Falvo, M., O’Brien III, ET, Watanabe, T., Hahn, K. und Superfine, R. Force Spectroscopy of Phagoocytosis with High Frame Rate 3D Light Blatt-Imaging. 62. Jahrestagung der Biophysical Society San Francisco, CA 2018. p. 530A. Abstrakt PDF

Shao C, Cribb, J., Osborne, L.D., O’Brien III, E.T., Superfine, R., Mayer-Patel, K. und Taylor II, R.M. (2018). Analysefähige Mikroskopie-Videokomprimierung. Mikroskopische Forschungstechnik. 81(7):693-703. PDF

Stefanini L, Lee, RH, Paul, DS, O’Shaughnessy, EC, Ghalloussi, D., Jones, CI, Boulaftali, Y., Poe, KO, Piatt, R., Kechele, DO, Caron, KM, Hahn, KM, Gimmins, J., M. und Bergmeier, W., (2018). Funktionelle Redundanz zwischen RAP1-Isoformen in der Blutplättchenproduktion und -funktion der Maus. Blut. 132(18):1951-62. Epub 2018 21. August PMC6213319. PDF

Tarbet HJ, Dolat, L., Smith, T.J., Condon, B.M., O’Brien III, E.T., Vladivia, R.H. und Boyce, M. (2018). Die ortsspezifische Glykosylierung reguliert die Form und Funktion des Zwischenfilament-Zytoskeletts ELIFE. 7. Epub 7. März 2018. PMC5841932 PDF

Tajadura-Ortega, V., Garg, R., Allen, R., Owczarek, C., Bright, MD, Kean, S., Mohd-Noor, A., Grigoriadis, A., Elston, TC, Hahn, KM , Ridley, AJ (2018). Ein RNAi-Screening von Rho-Signalnetzwerken identifiziert RhoH als Regulator von Rac1 bei der Migration von Prostatakrebszellen. BMC Biologie. 16(1): 29. PMC5840776. PDF

Van Haren J, Charafeddine, R. A., Ettinger, A., Wang, H., Hahn, K. M. und Wittman, T. (2018). Lokale Kontrolle der intrazellulären Mikrotubulusdynamik durch EB1-Photodissoziation. Natur Zellbiologie. 20(3): 1504. PMC5826794. PDF

Woroniuk A, Porter, A., White, G., Newman, DT, Diamontopoulou, Z., Waring, T., Rooney, C., Strathdee, D., Marston, DJ, Hahn, KM, Sansom, oJ, Zech , T. und Malliri, A. (2018). Die STEF/TIAM2-vermittelte Rac1-Aktivität an der Kernhülle reguliert die perinukleäre Aktinkappe. Naturkommunikation. 2(9):1. PMC5974301. PDF

Yan C, Wang, F., Peng, Y., Williams, CR, Jenkins, B., Wildonger, J., Kim, HJ, Perr, JB, Vaughan, JC, Kern, ME, Falvo, MR, O’Brien III, ET, Superfine, R., Tuthill, JC, Xiang, y., Rogers, SL und Parrish, JZ (2018). Mikrotubuli-Acetylierung ist für die Mechanosensation bei Drosophila erforderlich. Zellenberichte. 25(4):105-1065. PMC6248335 PDF

Yumerefendi H, Wang, H., Dickinson, D. J., Lerner, A. M., Malkus, P, Goldstein, B., Hahn, K. und Kuhlman, B. (2018). Lichtabhängige zytoplasmatische Rekrutierung erhöht den Dynamikbereich eines nuklearen Import-Photoschalters. ChemBioChem. 19(20): 1319-1325. PMC6013380. PDF

Dagliyan O., Karginov, A. V., Yagishita, S., Gale, M. E., Wang, H., DerMardirossian, C., Wells, C. M., Dokholyan, N. V., Kasai, H. und Hahn, K. M. (2017). Entwicklung von allosterischen Pak1-Schaltern. ACS Synthetische Biologie. 6(7):1257-62. PMC5562282. PDF

Hendrickx-Rodriguez S, Falvo, M.R., O’ Brien III, E.T. und Superfine, R. Auswirkungen von Opsonindichte und -typ auf die Phagozytose von Perlen. Biophysical Journal 2017. p. 90A-1A. – Abstrakt

Herrington K.A., Trinh, A.L., Dang, C., O’Shaughnessy, E., Hahn, K.M., Gratton, E., Digman, M.A. und Sütterlin, C. (2017). Die räumliche Analyse der Cdc42-Aktivität zeigt eine Rolle von Plasmamembran-assoziiertem Cdc42 bei der Zentrosomenregulation. Molekularbiologie der Zelle. 28(15):2135-45. PMC5509425. PDF

Markovetz MR, Seim, I., Ramsey, K., Garbarine, I. C., Forest, G. M., Schultz, A., Stick, S., Boucher, R. C. Bewertung von schleimbasierten Biomarkern der CF-Atemwegserkrankung. Pädiatrische Pneumologie 2017. p. S258. – Abstrakt

Takano T., Wu, M., Nakamuta, S., Naoki, H., Ishizawa, N., Namba, T., Watanabe, T., Xu, C., Hamaguchi, T., Yura, Y., Amano , M., Hahn, KM und Kaibuchi, K. (2017). Entdeckung von weitreichenden inhibitorischen Signalen, um die Bildung von 0,3 Einzelaxonen sicherzustellen. Naturkommunikation. 8(1):33. PMC5484694. PDF

Taylor AB, Joannou, M. S., Watanabe, T., Hahn, K. und Chew, T.L. (2017). Wahrnehmungsgenaue Darstellung von zwei Graustufenbildern als einfarbiges Bild. Zeitschrift für Mikroskopie. 268(1):73-83. PMC5637524. PDF

Walton BL, Hehmann, M., Skorczewski, T., Holle, LA, Beckman, JD, Cribb, JA, Mooberry, MJ, Wufsus, AR, Cooley, BC, Homeister, JW, Pawlinski, R., Falvo, MR, Key, NS, Fogelson, AL, Neeves, KB und Wolberg, AS (2017). Erhöhter Hämatokrit erhöht die Ansammlung von Blutplättchen nach Gefäßverletzungen. Blut. doi:746479. PMC5418635 PDF

Woodham EF, Paul, NR, Tyrrell, B., Spence, HJ, Swaminathan, K., Scribner, MR, Giampazolias, E., Hedley, A., Clark, W., Kage, F., Marston, DJ, Hahn , KM, Tait, SW, Larue, L., Brakebusch, CH, Insall, RH und Machesky, LM (2017). Koordination von Aktin, Kontraktilität und Adhäsion durch Cdc42 für die Melanoblastenbewegung in der Maushaut. Aktuelle Biologie. 27(5):624-37. PMC5344686. PDF

Ye F., Yang, C., Kim, J., MacNevin, C. J., Hahn, K. M., Park, D., Ginsberg, M. H. und Kim, C. (2017). Epigallocatechingallat hat pleiotrope Wirkungen auf die Transmembran-Signalgebung, indem es die Einbettung von Transmembran-Domänen verändert. Die Zeitschrift für biologische Chemie. 262(24):9858-64. PMC5473239. PDF

Blackmon, R. L., Sandhu, R., Chapman, B. S., Casbas-Hernandez, P., Tracy, J. B., Troester, M. A. und Oldenburg, A. L. (2016) Imaging Extracellular Matrix Remodeling In Vitro by Diffusion-Sensitive Optical Coherence Tomography. Biophysikalische Zeitschrift. 110(8):1858-68. PMC4850325. PDF

Burridge K. und Guilluy, C. (2016).Fokale Adhäsionen, Stressfasern und mechanische Spannungen. Experimentelle Zellforschung. S0014-4827(15):30131-2. PMC4891215 PDF

Cribb JA, Osborne, LD, Beicker, K., Psioda, M., Chen, J., O’Brien, ET, Taylor II, RM, Vicci, L., Hsiao, JP, Shao, C., Falvo, M ., Ibrahim, JG, Wood, KC, Blobe, GC und Superfine, R. (2016). Ein automatisiertes Hochdurchsatz-Array-Mikroskop für die Krebszellmechanik. Wissenschaftliche Berichte. 6:27371. PMC4893602 PDF

Dagliyan, O., Tarnawski, M., Chu, P. H., Shirvanyants, D., Schlichting, I., Dokholyan, N.V. und Hahn, K.M. (2016)Engineering extrinsische Störung zur Kontrolle der Proteinaktivität in lebenden Zellen. Wissenschaft. 354(6318):1441-1444. PMC5362825 PDF

Evans BA, Ronecker, J. C., Han, D. T., Glass, D. R., Train, T. L. und Deatsch, Alison, E. (2016). Funktionalisierte magnetische Mikrosphären aus Silikon mit hoher Permeabilität und geringer Autofluoreszenz für biomedizinische Anwendungen. Sonst. Epub 16. Februar 2016. doi:10.1016/j.msec.2016.01.094 PDF

Farzal Z, Walsh, J., Lopes de Rezende Barbosa, G., Zdanski, C.J., Davis, S.D., Superfine, R., Pimenta, L.A., Kimbell, J.S. und Drake, A.F. (2016). Volumetrische Nasenhöhlenanalyse bei Kindern mit ein- und beidseitiger Lippen-Kiefer-Gaumenspalte. Laryngoskop. 126(6):1475-1480. PMC4752420 PDF

Gentry L.R., Karginov A.V., Hahn K.M., Der C.J. (2016)Charakterisierung einer konstruierten Src-Kinase zum Studium der Src-Signalgebung und -Biologie. Methoden Molekularbiologie. 1360: 157-167. PMC4621786. PDF

Givens, C., und Tzima, E. (2016) Endotheliale Mechanosignalisierung: Passt ein Sensor für alle? Antioxidatives Redox-Signal. 25(7):373-388. PMC5011625 PDF

Lawrimore J, Aicher, J., Hahn, P., Fulp, A., Kompa, B., Vicci, L., Falvo, M., Taylor II, R. und Bloom, K. (2016). ChromoShake: Ein Chromosomendynamiksimulator zeigt, dass Chromatinschleifen das zentromerische Chromatin versteifen. Molekularbiologie der Zelle. 27(1):153-66. PMC4694754. PDF

MacNevin CJ, Toutchkine, A., Marston, D.J., Hsu, C-W., Tsygankov, D., Li,L., Liu, B., Qi, T., Nguyen, D-V. und Hahn, K.M. (2016). Die ratiometrische Bildgebung mit einem einzigen Farbstoff ermöglicht die gleichzeitige Visualisierung der Rac1- und Cdc42-Aktivierung. Zeitschrift der American Chemical Society. 138(8):2571-5. PMC4825053 PDF

Majoran RJ, Guilluy, C. und Burridge, K. (2016). Verwendung von Magneten und magnetischen Kügelchen, um Signalwege zu sezieren, die durch mechanische Spannungen auf Zellen aktiviert werden. Methoden 94:19-26. PMC4761479. PDF

Methoden und Systeme zur Verwendung von betätigten oberflächenbefestigten Stiften für die Biofluid-Rheologie, R. Superfine, R. Spero, B. Evans, B. Fiser, A. Shields, US-Patent 9,238,869 (1. Februar 2016)

Quammen, CW, Taylor II, RM, Krajcevski, P., Mitran, S., Enquobahrie, A., Superfine, R., Davis, B., Davis, S. und Zdanski, C. (2016) The Virtual Pediatric Airways-Werkbank. Studium der Gesundheitstechnik und Informatik. 220:295-300.PMC5588666 PDF

Scott DW, Tolbert, C. E., & Burridge, K (2016). Spannung auf JAM-A aktiviert RhoA über GEF-H1 und p115 RhoGEF. Molekularbiologie der Zelle. 27(9): 1420-30. PMC4850030. PDF

Spieser, DL, Gagnon, YL, Chhetri, RK, Oldenburg, AL, und Johnsen, S. (2016) Untersuchung der Auswirkungen von chromatischer Aberration, Objektabstand und Augenform auf die Bildentstehung in den spiegelbasierten Augen der Bucht Jakobsmuschel Argopecten irradians. Integrative und vergleichende Biologie. 56(5):796-808.PMC5886045 PDF

Wang, H., Vilela, M., Wink.er, A., Tarnawski, M., Schlichting, I., Yumerefendi, H., Kuhlman, B., Liu, R., Danuser, G. und Hahn, KM (2016)LOVTRAP: ein optogenetisches System für die photoinduzierte Proteindissoziation. Natur Methoden. 13(9):755-758. PMC5137947 PDF

Wang, H. und Hahn, K.M. (2016)LOVTRAP: Eine vielseitige Methode zur Kontrolle der Proteinfunktion mit Licht. Aktuelle Protokolle in der Zellbiologie. 73:21. PMC5137945. PDF

Bucay, I., O’Brien III, E. T., Wulfe, S., Superfine, R., Wolberg, A., Falvo, M. und Hudson, N. (2015). Physikalische Determinanten der Fibrinolyse in einzelnen Fibrinfasern. Plus eins. DOI: 10.1371/journal.pone.011635. PMC4340865 PDF

Crassous JJ, Mihut, A. M., Mansson, L. K. und Schurtenberger, P. (2015). Anisotrop responsive Mikrogele mit einstellbarer Form und Wechselwirkungen. Nanoskala. 7(38):15971-82. PDF

Cribb, J., Osborne, L., Hsiao, J., Vicci, L., Meshram, A., O’Brien III, ET, Spero, R., Taylor II, R. und Superfine, R. (2015 ). Ein Hochdurchsatz-Array-Mikroskop zur mechanischen Charakterisierung von Biomaterialien. AIP Review of Scientific Instruments 86(023711). PMC4344474 PDF

Du K, Zheng, S., Zhang, Q., Li, S., Gao, X., Wang, J., Jiang, L. und Liu, K. (2015). Pten-Deletion fördert das Nachwachsen von Axonen des kortikospinalen Trakts 1 Jahr nach einer Rückenmarksverletzung. Die Zeitschrift für Neurowissenschaften. 35(26):9754-63. PDF

Fiser B, Shields, A., Falvo, M. und Superfine, R. (2015). Hochreaktive Kern-Schale-Mikroaktuator-Arrays für den Einsatz in viskosen und viskoelastischen Flüssigkeiten. Zeitschrift für Mikromechanik und Mikrotechnik 25(2). PMC4577244 PDF

Grube M, Cernava, T., Sho, J., Fuchs, S., Aschenbrenner, I., Lassek, C., Wegner, U., Becher, D., Riedel, K., Sensen, CW und Berg, G. (2015). Untersuchung funktioneller Zusammenhänge symbiotischer Erhaltung innerhalb von Flechten-assoziierten Bakterien durch vergleichende Omics. Das ISME-Journal. 9(2):412-24. PMC4303634. PMC4303634 PDF

Guilluy C., Burridge, K. (2015). Nukleare Mechanotransduktion: Zwingt den Kern, zu reagieren. Kern. 6(1):19-22. PMC4615784. PMC4615784 PDF

Judith, R., Fisher, J., Spero, R., Fiser, B., Turner, A., Oberhardt, B., Taylor II, R., Falvo, M, Superfine, R. und Lab Chip (2015 ). “Mikroelastometrie an Vollblutgerinnseln unter Verwendung von aktivierten oberflächengebundenen Stiften (ASAPs).” Lab Chip 15(5): 1385-1393. PMC4545258 PDF

Lawrimore J, Vasquez, P. A., Falvo, M., Taylor II, R., Vicci, L., Yeh, E., Forest M. G. und Bloom, K. (2015). DNA-Schleifen erzeugen bei der Mitose eine intrazentromere Spannung. Die Zeitschrift für Zellbiologie. 210(4):553-64. PMC4539978 PDF

Li, S., He, Q., Wang, H., Tang, X., Ho, KW, Gao, X., Zhang, Q., Shen, Y., Cheung, A., Wong, F., Ip , NY, Jiang, L., Yung, WH und Liu, K. (2015). Verletzte adulte retinale Axone mit Pten- und Socs3-Co-Deletion reformieren aktive Synapsen mit suprachiasmatischen Neuronen. Neurobiologie der Krankheit. 73:366-76. PDF

Mair l, Weinberg, I., Nacev, A., Urdaneta, M., Stepanov, P., Hilaman, R., Himelfarb, S. und Superfine, R. (2015). Analyse des getriebenen Nanostäbchentransports durch eine Biopolymermatrix. Zeitschrift für Magnetismus und magnetische Materialien. 380:295-298 PMC4321758 PDF

Murray E., Sayyar, S., Thompson, B.C., Gorkin III, R., Officer, D.L. und Wallace, G.G. (2015). Ein umweltfreundlicher, grüner Weg zu verarbeitbaren, biokompatiblen Graphen/Polymer-Verbundwerkstoffen. RSC-Fortschritte. 5(56):45284-90. PDF

Sears, P., Blackmon, R., Lynch, S., Superfine, R., Oldenburg, A. und Ostrowski, L.E. (2015)Mukoziliärer Transport in zirkulären Kulturen primärer menschlicher Atemwegsepithelzellen: Wirkung der Ziliarschlagfrequenz und Schleimkonzentration. Pädiatrische Lungen. 50:234-235. Abstrakt

Shao C, Zhong, A., Cribb, J., Osborne, L.D., O’Brien III, E.T., Superfine, R., Mayer-Patel, K., Taylor II, R.M. (2015). Analyseerhaltende Videomikroskopie-Kompression durch Korrelation und mathematische Morphologie. Mikroskopische Forschung und Technik. PMC4715596. PDF

Kurz B (2015). Die Spannung steigt an zentromerischen Schleifen an. Die Zeitschrift für Zellbiologie. 210(4):523. PDF

Vicory J, Couture, H. D., Thomas, N. E., Borland, D., Marron, J. S., Woosley, J. und Niethammer, M. (2015). Aussehensnormalisierung von Histologie-Objektträgern. Computergestützte medizinische Bildgebung und Grafiken. 43:89-98. PMC4769595. PMC4769595 PDF

Wen B, Campbell, K. R., Cox, B. L., Eliceiri, K. W., Superfine, R. und Campagnola, P. J. Multi-View-Bildgebung der zweiten Harmonischen Generation der Mausschwanzsehne über reflektierende Mikroprismen. In: Briefe O, Herausgeber. Juli 2015: Optical Society America 2015. p. 3201-4. PMC4979975 PDF

Yi JJ, Berrios, J., Newbern, J. M., Snider, W. D., Philpot, B. D., Hahn, K. M. und Zylka, M. J. (2015). Eine mit Autismus verbundene Mutation deaktiviert die Phosphorylierungssteuerung von UBE3A. Zelle. 162(4):795-807. PMC4537845. PMC4537845 PDF

Yumerefendi H, Dickinson, D. J., Wang, H., Zimmerman, S. P., Bear, J. E., Goldstein, B., Hahn, K. und Kuhlman, B. (2015). Kontrolle der Proteinaktivität und Spezifizierung des Zellschicksals durch lichtvermittelte Kerntranslokation. Plus eins. 10(6):E0128443. PMC4471001. PMC4471001 PDF

Zdanski C, Davis, S., Hong, Y., Miao, D., Quammen, C., Mitran, S., Davis, B., Niethammer, M., Kimbll, J., Pitkin, E., Fine, J., Fordham, L., Vaughn, B. und Superfine, R. (2015). Quantitative Beurteilung der oberen Atemwege bei Säuglingen und Kindern mit subglottischer Stenose. Laryngoskop. PMC5257243 PDF

Bays J., Peng, X., Tolbert, E., Guilluy, C., Angell, A., Pany, Y., Superfine, R., Burridge, K., & Demali, A (2014). Die Vinculin-Phosphorylierung reguliert differentiell die Mechanotransduktion bei Zell-Zell- und Zell-Matrix-Adhäsionen. Zeitschrift für Zellbiologie. 205(2):251-63. PMC4003237. PDF

Beicker KN, O’Brien III, E.T., Falvo, M. & Superfine, R. (2014). Betrachten der Kerndeformation mit seitlicher Mikroskopie. Biophysikalische Gesellschaft 106(2):42A-43A. (abstrakt)

Bloom KS (2014). Centromeres Heterochromatin: die primordiale Segregationsmaschine. Jährliche Überprüfung der Genetik. (48):457-84. PMC4245377. PDF

Chhetri, R., K., Blackmon, R., Wu, W.-C., Hill, DB, Button, B., Casbas-Hernandez, P., Troester, M., Tracy, JB und Oldenburg, AL (2014). “Untersuchung der biologischen Nanotopologie durch Diffusion von schwach eingeschränkten plasmonischen Nanostäbchen mit optischer Kohärenztomographie.” Proceedings of the National Academy of Sciences 111(41): E42897-E44297. PMC4205670. PDF

Collins, C, Osborne, L., Guilluy C., Chen, Z., O’Brien III, E., Reader, J., Burridge, K., Superfine, R., & Tzima, E. (2014) Hämodynamik und extrazelluläre Matrix-Hinweise regulieren den mechanischen Phänotyp und die Steifheit von Aorten-Endothelzellen. Nature Communications 5:3984. doi:10.1038/ncomms4984 PMC4068264 PDF

Davidson Ward S., Amin, R., Arens, R., Chen, Z., Davis, S., Gutmark, E., Superfine, R., Wong, B., Zdanski, C. und Khoo, M. (2014). Pädiatrische schlafbezogene Atemstörungen: Fortschritt in Bildgebung und Computermodellierung. IEEE-Impuls. (September/Oktober): 33-9. PDF

Fisher J. &. Kleckner, N. (2014). Magnetkraft-Mikrokolben: ein integriertes Kraft-/Mikrofluidik-Gerät zum Aufbringen von Druckkräften in einer beengten Umgebung. Die Überprüfung wissenschaftlicher Instrumente. 85(2):023704. PMC3970836 PDF

Guilluy, C, Osborne, LD, Van Landeghem, L., Sharek, L., Superfine, R., Garcia-Mata, R. und Burridge, K. (2014) Isolierte Kerne passen sich an Kraft an und zeigen einen Mechanotransduktionsweg in der Kern. Natur Zellbiologie. 16(4):376-381. PMC4085695 PDF

Hill D, Vasques, P., Mellnik, J., McKinley, S., Vose, A., Mu, F., Henderson, A., Donaldson, S, Alexis, N., Boucher, R., & Forest, M. (2014). Eine biophysikalische Grundlage für die Konzentration von Schleimfeststoffen als Biomarker-Kandidat für Atemwegserkrankungen. Plus eins. 9(2):e87681. PMC3928107. PDF

Hong Y, Davis, B., Marron, JS, Kwitt, R., Sing, N., Kimbell, JS, Pitkin, E., Superfine, R., Davis, SD, Zdanski, CJ, & Niethammer, M. ( 2014). Statistische Atlaskonstruktion über gewichtete Funktionsboxplots. Medizinische Bildanalyse. 18(4):684-98. PMC4029168. PDF

Hong Y, Singh, N., Kwitt, R., Vasconcelos, N. und Niethammer, M., (2014). Geodätische Regression auf dem Grassmann. Proceedings of the European Conference on Computer Vision. (Referenziert, 15 Seiten) PDF

Hong Y, Gao Y, Niethammer M, Bouix S. 2014. Tiefenbasierte Formanalyse. Proceedings of the International Conference on Medical Image Computing and Computer Assisted Intervention (MICCAI). (Referenziert, 8 Seiten). Student Best Paper Award. PDF

Hong Y, Singh, N., Kwitt, R. und Niethammer, M. (2014). Zeitverzerrte geodätische Regression. Proceedings of the International Conference on Medical Image Computing and Computer Assisted Intervention.(Referenziert, 8 Seiten) PDF

Huang L, Hsiao, J. P., Poierza, C. Taylor II, R. und Lord, S. (2014). Treibt die Topologie die Faserpolymerisation an? Biochemie. 53(49):7824-34. PMC4270379. PDF

Lee, W., Leddy, HA, Chen, Y., Lee, SH, Zelenski, NA, McNulty, AL, Wu, J., Bieker, K., Coles, J., Zauscher, S., Sachs, J. , Guilak, F. und Liedtke, W. (2014). “Synergie zwischen Piezo1- und Piezo2-Kanälen verleiht dem Gelenkknorpel eine hohe mechanische Empfindlichkeit.” Proceedings of the National Academy of Sciences 111(47): E5114-E5522. PMC4250098. PDF

Lessey-Morillon, E, Osborne, L., Monaghan-Benson, E., Guilluy, C., O’Brien III, ET, Superfine, R., & Burridge, K. (2014) The RhoA GEF, LARG, vermittelt ICAM-1-abhängige Mechanotransduktion in Endothelzellen zur Stimulierung der transendothelialen Migration. Die Zeitschrift für Immunologie. 192(7):3390-3398. PMC3991232 PDF

Mair LO und Superfine, R. (2014). Einzelpartikelverfolgung zeigt biphasischen Transport während der Nanostäbchen-Magnetophorese durch die extrazelluläre Matrix. Weiche Materie. 10(23):4118-25. PMC4265469 PDF

Majoram, R. J., Lessey, E. C., &. Burridge, K. (2014). Regulation der RhoA-Aktivität durch Adhäsionsmoleküle und Mechanotransduktion. Aktuelle Molekulare Medizin. 14(2):199-208. PMC3929014. PDF

Mellnik J, Vasquez, P. A., McKinley, S. A., Witten, J., Hill, D. B., Forest, M. G. (2014). Mikroheterogenitätsmetriken für die Diffusion in weicher Materie. Weiche Materie. 10(39):7781-96. PMC4186960. PDF

Osborne, L.D., Li, G.Z., How, T., O’Brien, E.T. 3., Blobe G. C., Superfine, R. und Mythreye, K. (2014). “TGF-β reguliert LARG und GEF-H1 während der EMT, um die versteifende Reaktion auf Kraft und Zellinvasion zu beeinflussen.” Molecular Biology of the Cell 25(22): 3528-3540. PMC4230614. PDF

Osborne LD, Cribb, J., Vicci, L., O’Brien III E.T., Hsiao, J., Taylor, R.M. II, & Superfine, R. (2014). Array-Mikroskop zur Charakterisierung der Steifigkeit mit hohem Durchsatz in der Krebsbiologie. Biophysikalische Gesellschaft 106(2):619A-619A. (abstrakt)

Shan L, Zach, C., Charles, C. und Niethammer, M., (2014). Automatische Atlas-basierte Knorpelsegmentierung mit drei Markierungen aus MR-Kniebildern. Medizinische Bildanalyse. 18 (7): 1233-46. PDF

Sing N., Couture, H. D., Marron, J. S., Perou, C., & Niethammer, M. Topological Descriptors of Histology Images. Maschinelles Lernen in der medizinischen Bildgebung: Springer International Publishing 2014. p. 231-239. Buchkapitel. PDF

Sing N. und Niethammer, M., (2014). Splines für die Diffeomorphe Bildregression. Proceedings of the International Conference on Medical Image Computing and Computer Assisted Intervention. 17: 121-9. PDF

Taylor II R, Shao, C., Zhong, A. und Mayer-Patel, K., Erfinder METHODEN, SYSTEME UND COMPUTER LESEBARE MEDIEN ZUR KOMPRESSION VON VIDEOBILDERN. Vorläufige US-Patentanmeldung 2014.

Taylor II R und Harter, J., (2014). Zufällige Luminanzmodulation pro Element für verbessertes visuelles Tracking. IEEE-Computergrafik und -Anwendungen. 34(6):83-87. PDF

Thompson M, Tolbert, C., Shen, K., Kota, P., Palmer, S., Plevock, K., Orlova, A., Galkin, V., Burridge, K., Egelman, E., Dokholyan, N., Superfine, R., & Campbell, S. (2014). Identifizierung einer Actin-bindenden Oberfläche auf Vinculin, die mechanische Zell- und fokale Adhäsionseigenschaften vermittelt. Struktur. 22(5):697-706. PMC4039106 PDF

Tolbert CE, Thompson, P. M., Superfine, R., Burridge, K., Campbell, S.L. (2014). Phosphorylierung an Y1065 in Vinculin vermittelt Aktinbündelung, Zellausbreitung und mechanische Reaktionen auf die Kraftbiochemie. 53(34):5526-36. PMC4151700. PDF

Waldon, S., Thompson, P., Hahn, P., Taylor II, R. (2014). “SketchBio: Die 3D-Schnittstelle eines Wissenschaftlers für molekulare Modellierung und Animation.” BMC Bioinformatics Journal 15(334). PMC4287593 PDF

Wijesundara K, Zdanski, C., Kimbell, J., Price, H., Iftimia, N. und Oldenburg, A. L. (2014). Quantitative Endoskopie der oberen Atemwege mit anatomischer optischer Kohärenztomographie mit Swept-Source. Biomedizinische Optik Express. 5(3):788-799. PMC3959831. PDF

Zhao Q, Pizer, S., Niethammer, M. und Rsoenman, I., (2014). Geometrisches Merkmal-basiertes Spektraldiagramm-Matching in der Rachenoberflächenregistrierung. Proceedings of the International Conference on Medical Image Computing and Computer Assisted Intervention. (Referenziert, 8 Seiten). PMC4382356 PDF

Notiz: Die Informatik-Community verwendet Konferenzbände als Hauptverbreitungsmedium, mit Akzeptanzquoten von oft weniger als 30%. Sie haben daher den Status von referierten Zeitschriftenartikeln.

Neue TRD2. Referenzen zu biomolekularen Bildgebungstools: Wir berichten über die aktuellen Referenzen von TRD PI Prof. Klaus Hahn. Diese Arbeit hat nicht wurde im letzten Jahr von CISMM selbst unterstützt, aber wir berichten hier, um den Zugang zu erleichtern und Informationen über Möglichkeiten der Zusammenarbeit zu erhalten.

Helassa N, Garnett JP, Farrant M, Khan F, Pickup JC, Hahn KM, MacNevin CJ, Tarran R, Baines DL. Ein neuartiges fluoreszierendes Sensorprotein zur Erkennung von Veränderungen der flüssigen Glukosekonzentration der Atemwegsoberfläche. Biochem J. 2014 Sept. 15. [Epub vor Druck] PMID: 25220254

Weitzman M, Hahn KM.Optogenetische Ansätze zur Zellmigration und darüber hinaus. Curr Opin Cell Biol. 2014 Okt30C: 112-120. doi: 10.1016/j.ceb.2014.08.004. Epub 2014 Sept. 15. PMID: 25216352

Chu PH, Tsygankov D, Berginski ME, Dagliyan O, Gomez SM, Elston TC, Karginov AV, Hahn KM. Die konstruierte Kinaseaktivierung zeigt einzigartige morphodynamische Phänotypen und den damit verbundenen Handel mit Isoformen der Src-Familie. Proc Natl Acad Sci U S A. 2014 Aug 26111(34):12420-5. doi: 10.1073/pnas.1404487111. PMID: 25118278 [PubMed – in Bearbeitung]

Tsygankov D, Chu PH, Chen H, Elston TC, Hahn KM. Benutzerfreundliche Tools zur Quantifizierung der Dynamik der Zellmorphologie und intrazellulärer Proteincluster. Methoden Zellbiol. 2014123:409-27. doi: 10.1016/B978-0-12-420138-5.00022-7. PMID: 24974040 [PubMed – in Bearbeitung]

Yi JJ, Wang H, Vilela M, Danuser G, Hahn KM Manipulation der endogenen Kinaseaktivität in lebenden Zellen mit photoschaltbaren inhibitorischen Peptiden. ACS Synth Biol. 2014 Jun 13. PMID: 24905630

Karginov AV, Hahn KM, Deiters A.Optochemische Aktivierung der Kinasefunktion in lebenden Zellen.Methoden Mol Biol. 20141148:31-43. doi: 10.1007/978-1-4939-0470-9_3. PMID: 24718793

Sezierende Motilitätssignalisierung durch Aktivierung spezifischer Src-Effektor-Komplexe. Nat. Chem. Biol. 2014 Apr10(4):286-90. doi: 10.1038/nchembio.1477. Epub 2014 Mär 9. Erratum in: Nat Chem Biol. 2014 Aug10(8):692. PMID: 24609359

Hinde E, Yokomori K, Gaus K, Hahn KM, Gratton E. Fluktuationsbasierte Bildgebung der nuklearen Rac1-Aktivierung durch Proteinoligomerisierung. Sci Rep. 2014 Feb 274:4219. doi: 10.1038/srep04219. PMID: 24573109

Tsygankov D, Bilancia CG, Vitriol EA, Hahn KM, Peifer M, Elston TC. CellGeo: eine Computerplattform zur Analyse von Formänderungen in Zellen mit komplexen Geometrien. J Cell Biol. 2014 Feb 3204(3):443-60. doi: 10.1083/jcb.201306067. PMID: 24493591

Morrow PK, Broxson AC, Munsell MF, Basen-Enquist K, Rosenblum CK, Schover LR, Nguyen LH, Hsu L, Castillo L, Hahn KM, Litton JK, Kwiatkowski DN, Hortobagyi GN. Einfluss von Alter und Rasse auf die Lebensqualität bei jungen Brustkrebsüberlebenden. Clin Brustkrebs. 2014 Apr14(2):e21-31. doi: 10.1016/j.clbc.2013.10.003. Epub 2013 25. Okt. PMID: 24461458

Khalil BD, Hanna S, Saykali BA, El-Sitt S, Nasrallah A, Marston D, El-Sabban M, Hahn KM, Symons M, El-Sibai M . Exp Cell Res. 2014 Febr. 15321(2):109-22. doi: 10.1016/j.yexcr.2013.11.023. Epub 2013 Dez. 10. PMID: 24333506

Cai D, Chen SC, Prasad M, He L, Wang X, Choesmel-Cadamuro V, Sawyer JK, Danuser G, Montell DJ. Mechanisches Feedback durch E-Cadherin fördert die Richtungserkennung während der kollektiven Zellmigration. Zelle. 2014 Mai 22157(5):1146-59. doi: 10.1016/j.cell.2014.03.045. PMID: 24855950

Martin K, Vilela M, Jeon NL, Danuser G, Pertz O. Ein durch Wachstumsfaktoren induziertes, räumlich organisierendes Zytoskelettmodul ermöglicht eine schnelle und anhaltende Fibroblastenmigration. Entwicklerzelle. 2014 Sep. 2930(6):701-16. doi: 10.1016/j.devcel.2014.07.022. PMID: 25268172

Burridge K, &. Wittchen, E. (2013). Die Spannungsberge: Spannungsfasern als krafterzeugende Mechanowandler. Zeitschrift für Zellbiologie. 200(1):9-19. PMC3542796. PDF

Calloway, H., Kimbell, J., Davis, S., Retsch-Bogart, G., Pitkin, E., Abode, K. & Superfine, R. (2013). Vergleich von endoskopischen und 3D-CT-abgeleiteten Atemwegsmessungen. Laryngoskop.123(9):2136-2141 PDF

Cao, T., Jojic, V., Modla, S., Powell, D., Czymmek, K., &. Niethammer, M. (2013). Robustes multimodales Wörterbuchlernen. . Gesellschaft für medizinische Bildverarbeitung und computergestützte Intervention. Buchkapitel PDF

Cao T, Zach, C., Modla, S., Powell, D., Czymmek, K. und Niethammer, M. (2014). Multimodale Registrierung für die korrelative Mikroskopie unter Verwendung von Bildanalogien. Medizinische Bildanalyse. 18(6):914-26. PMC4062605. PDF

Collins, C., & Tzima, E. (2013). RhoA wird GLOBAL. Kleine GTPases.4(2):123-126. PMC3747253 PDF

Cribb, J., Vasquez, P., Moore, P., Norris, S., Shah, S., Forest, M., Superfine, R. (2013). Nichtlineare Signaturen in der Rheologie von aktiven Mikrokügelchen verschränkter Polymerlösungen. Journal of Rheology.57(4):1247-1264. PMC3920902 PMC3920902/PDF

Csapo, I, Davis, B., Shi, Y., Sanchez, M., Styner, M., Niethammer, M. (2013)Längsbildregistrierung mit zeitabhängigem Bildähnlichkeitsmaß. IEEE-Transaktionen zur medizinischen Bildgebung. 32(10):1939-1951. PMC3947578 PMC3947578 /PDF

Dutta, S., Horita, D., Hantgan, R., &. Guthold, M. (2013). UNTERSUCHUNG von αIIbβ3: LIGAND-INTERAKTIONEN DURCH DYNAMISCHE KRAFTSPEKTROSKOPIE UND OBERFLÄCHENPLASMON-RESONANZ. Nano LIFE.03(01) PMC3788690 PMC3788690/PDF

Fisher J, Bourniguel, A., Witz, G., Weiner, B., Prentiss, M., & Kleckner, N. (2013). Vierdimensionale Bildgebung der nukleoiden Organisation und Dynamik von E. coli in lebenden Zellen. Zelle. 153(4):882-95. PMC3670778 PDF

Funkhouser 3rd, K. W., Niethammer, M., Carson, J., Burns, K., Knowles, M., Leigh, M., Zariwala, M., & Funkhouser Jr, W.K. (2013). Ein neues Tool verbessert die diagnostische Testleistung für die Transmissions-EM-Bewertung von Axonemal-Dynein-Armen. Ultrastrukturelle Pathologie. PMC3990650 PDF

Haase, J., Mishra, P., Stephens, A., Haggerty, R., Quammen, C., Taylor II, R., Yeh, E., Basrai, M., & Bloom, K., (2013) Eine 3D-Karte des Hefe-Kinetochors zeigt das Vorhandensein von Kern- und akzessorischem Zentromer-spezifischem Histon. Aktuelle Biologie. 23(19):1936-1944. PMC3796065 PDF

Hanna, S., , Krishnan, B., Bailey, S., Moschos, S., Kuan, P., Shimamura, T., Osborne, L., Siegel, M., Duncan, L., O’Brien III , E., Superfine, R., Miller, C., Simon, M., Wong. K. und Kim, W. (2013). HIF1α und HIF2α aktivieren SRC unabhängig voneinander, um Melanommetastasen zu fördern. Zeitschrift für klinische Untersuchung. 123(5):2978-2093. PMC3635738 PMC3635738/PDF

Herschlaq, G., Garcia, G. J., Button, B., Tarran, R., Lindley, B., Reingardt, B., Elston, T. C., & Forest, G. M. (2013). Ein mechanochemisches Modell zur Autoregulation des Oberflächenschichtvolumens der Atemwege der Lunge. Zeitschrift für Theoretische Biologie. (325)42-51. PMC3631568 PDF

Hong, Y., Davis, B., Marron, J., Kwitt, R., &. Niethammer, M. (2013). Gewichteter funktionaler Boxplot mit Anwendung auf die statistische Atlaskonstruktion. Gesellschaft für medizinische Bildverarbeitung und computergestützte Intervention. 16(Pt 3):584-591. Buchkapitel PDF

Hong, Y., Niethammer, M., Andruejol, J., Kimbell, J., Pitkin, E., Superfine, R., Davis, S., Zdanski, C. und Davis, B. (2013). Ein Atlas der pädiatrischen Atemwege und seine Anwendung bei subglottischer Stenose. Internationales Symposium zur biomedizinischen Bildgebung: Vom Nano zum Makro. PDF

Horowitz, E., Rahman, S., Bower, B., Dismuke, D., Falvo, M., Griffith, J., Harvey, S. und Asokan, A. (2013). Biophysikalische und ultrastrukturelle Charakterisierung der Adeno-assoziierten viralen Kapsid-Enthüllung und Genom-Freisetzung. Journal of Virology.87(6):2994-3002. PMC3592113 PMC3592113/PDF

Hudson, N., Ding, F., Bucay, I., O’Brien III, ET, Gorkun, O., Superfine, R., Lord, S., Dokholyan, N., & Falvo, M. (2013) . Ein elastischer Rückstoß im Submillisekundenbereich zeigt die molekularen Ursprünge der Fibrinfasermechanik. Biophysikalische Zeitschrift. 104(12):2671-2680. PMC3686331 PDF

Jones, G, Blonder, R., Gardner, G., Alve, V., Falvo, M., & Chevrier, J. (2013)Nanotechnologie und Nanowissenschaft: Herausforderungen für die Bildung der nächsten Generation. Internationale Zeitschrift für naturwissenschaftliche Bildung. online. “Nicht von NIH unterstützt”

Kohli L, Whitton, M. und Brooks, F. (2013). Umgeleitetes Berühren: Training und Anpassung in Warped Virtual Spaced. Proceedings of 2013 IEEE Symposium on 3D User Interfaces 3DUI.79-86. PDF

Mitran, S. (2013). Kontinuumskinetisch-mikroskopisches Modell der Lungenclearance aufgrund von Kern-Annular-Fluid-Entrainment. Zeitschrift für Computerphysik. (244):193-211.PMC3665523 PDF

Niethammer, M. und Zach, C. (2013). Segmentierung mit Bereichsbeschränkungen. Medizinische Bildanalyse.17(1):101-112. PMC3656501 PMC3656501/PDF

Oldenburg, A., Chhetri, R., Cooper, J., Wu, W., Troeste, M., & Tracy, J. (2013) Motilitäts-, Autokorrelations- und Polarisations-sensitive optische Kohärenztomographie unterscheidet Zellen und Gold Nanostäbchen in 3D-Gewebekulturen. Optik Briefe. 38(15):2923-2926. PMC3856705 PDF

Qian, X., Song, J. M., Melkamu, T., Upadhyaya, P., & Kassie, F. (2013)Chemoprävention der Lungentumorogenese durch intranasal verabreichtes Diindolylmethan in A/J-Mäusen. Karzinogenese. 34(4):841-849. PMC3616664 PDF

Samson T, van Buul, J., Droon, J., Welch, C., Bakker, E., Matlung, H., van den Berg, T., Sharek, L., Doerschuk, C., Hahn, K. , & Burridge, K. (2013). Der Guanin-Nukleotid-Austauschfaktor SGEF spielt eine entscheidende Rolle bei der Entstehung von Arteriosklerose. Plus eins. 8(1):55202. PMC3555862. PDF

Stephens, A., Haggerty, R., Vasquez, P., Vicci, L., Snider, C., Shih, F., Quammen, C., Mullins, C., Haase, J., Taylor II, R. , Verdaasdonk, J., Falvo, M., Jin, Y. Forest, G., & Bloom, K. (2013). Perizentrische Chromatinschleifen fungieren als nichtlineare Feder im mitotischen Kraftausgleich. Journal of Cell Biology.200(6):757-772. PMC3601350 PMC3601350/PDF

Stephens A, Snider, C., Haase, J., Haggerty, R., Vasquez, P., Forest, M., & Bloom, K. (2013). Einzelne Pericentromere zeigen eine koordinierte Bewegung und Dehnung in der Hefespindel. Zeitschrift für Zellbiologie. 203(3):407-16. PMC3824013 PDF

Stephens A, Quammen, C., Chang, B., Haase, J., Taylor, R., & Bloom, K. (2013). Die räumliche Segregation von perizentrischem Cohesin und Condensin in der mitotischen Spindel. Molekularbiologie der Zelle. 24(24):3909-19. PMC3861086 PDF

Tolbert C., Burridge, K., & Campbelle, S. (2013). Vinculin-Regulation der F-Aktin-Bündelbildung: Was bedeutet das für die Zelle? Zelladhäsion und Migration. 7(2):219-25. PMC3954036. PDF

Tretter, T., Jones, M., & Falvo, M. (2013). Nanowissenschaften für alle: Strategien zum Unterrichten von Nanowissenschaften für Bachelor-Studierende in Naturwissenschaften und nicht-wissenschaftlichen Studiengängen. Journal of Nano Education.5(1):1-9. “Nicht von NIH unterstützt’

Varshney, RK, Song, C., Saxena, RK, Azam, S., Yu, S., Sharpe, AG, Cannon, S., Baek, J., Rosen, BD, Tar’an, B., Millan, T., Zhang, X., Ramsay, LD, Iwata, A., Wang, Y., Nelson, W., Farmer, AD, Gaur, PM, Soderlund, C., Penmetsa, RV, Xu, C., Bharti , AK, He, W., Winter, P., Zhao, S., Hane, JK, Carrasquilla-Garcia, N., Condie, JA, Upadhyaya, HD, Luo, MC, Thudi, M., Gowda, CL, Singh, NP, Lichtenzveig, J., Gali, KK, Rubino, J., Nadarajan, N., Dolezel, J., Bansal, KC, Xu, X., Edwards, D., Zhang, G., Kahl, G ., Gil, J., Sing, KB, Datta, SK, Jackson, SA, Wang, J., & Cook, DR (2013)Entwurf der Genomsequenz von Kichererbsen (Cicer arietinum) bietet eine Ressource für die Verbesserung von Merkmalen. Nationale Biotechnologie. 31(3):240-246. PDF

Vasquez, P., Jin, Y., Yuong, K., Hill, D. B., & Forest, G. (2013). Eine neue Wendung des zweiten Problems von Stokes: Partielles Eindringen von Nichtlinearität in gescherte viskoelastische Schichten. Journal of Non-Newtonian Fluid Mechanics.196(0):36-50. PDF

Verdaasdonk J., Vasquez, P., Barry, R., Barry, T., Goodwin, S., Forest, M., & Bloom, K. (2013). Centromer-Tethering begrenzt Chromosomendomänen. Molekulare Zelle. 52(6):819-31. PMC3877211 PDF

J. Verdaasdonk, A. Stephens, J. Haase und K. Bloom (2013). Bending the Rules: Widefield Microscopy and the Abbe Limit of Resolution Journal of Cellular Physiology. 229(2):132-8. PMC4076117. PDF

Wijesundara, K., Iftimia, N., & Oldenburg, A. (2013). Design eines Swept-Source, anatomischen OCT-Systems für die pädiatrische Bronchoskopie. Verfahren der SPIE. 8571. doi: 10.1117/12.2004226. PMC3864962 PDF

Alabi, O., Wu, X., Harter, J., Phadke, M., Pinto L., Petersen, H. Bass, S., Keifer, M., Zhong, S., Healey, C. und Taylor II, R. Vergleichende Visualisierung von Ensembles mit Ensemble Surface Slicing. Proceedings of SPIE Visualization and Data Analysis 2012 Januar 2012 Burlingame, California.8294:82940U. PMC3614370 PMC3614370/PDF

Button, B., Cai, L. H., Ehre, C., Kesimer, M., Hill, D. B., Sheehan, J., Boucher, R. und Rubinstein, M. (2012). Eine periziliäre Bürste fördert die Lungengesundheit, indem sie die Schleimschicht von den Atemwegsepithelien trennt. Wissenschaft.337(6097):937-941. PMC3633213 PMC3633213/PDF

Camassa, R., Forest, M. G., Lee, L., Ogrosky, H. R., Olander, J. (2012). Ringwellen als Massentransportmechanismus in luftgetriebenen Kernringströmungen. Physische Überprüfung. E, Statistische, nichtlineare und weiche Materiephysik. 86(6 Pt 2) PDF

Cao, T., Zach, C., Modla, S., Powell, D., Czymmek, K. und Niethammer, M. (2012). Registrierung für die korrelative Mikroskopie mit Bildanalogien. Biomedizinische Bildregistrierung (WBIR).7359:296-306 NIHMS596525 PDF

Chhetri, R., Phillips, Z., Torester, M., & Oldenburg, A. (2012)Längsstudien von Brustepithel- und Fibroblasten-Kokulturen mit optischer Kohärenztomographie zeigen morphologische Kennzeichen der Prämalignität. Plus eins. 7(11):e49148. PMC3495770 PMC3495770/PDF

Collins, C., Guilluy, C., Welch, C., O’Brien, T., Hahn, K., Superfine, R., Burridge, K. und Tzima, E. (2012). Lokalisierte Spannungskräfte auf PECAM-1 lösen eine globale Mechanotransduktionsantwort über den Integrin-RhoA-Weg aus. Aktuelle Biologie.22(22):2087-2094. PMC3681294 PDF

Csapo, I., Davis, B., Shi, Y., Sanchez, M., Styner, M., Niethammer, M. (2012). Längsbildregistrierung mit ungleichmäßiger Erscheinungsbildänderung. Medizinische Bildverarbeitung und computergestützte Intervention (MICCAI). 15(Teil 3):280-288. PMC3584325 PMC3584325/PDF

Didier G, McKinley, S., Hill, D. B., &. Fricks, J. (2012). Statistische Herausforderungen in der Mikrorheologie. Zeitschrift für Zeitreihenanalyse. 33(5):724-43. PDF

Evans, B., Fiser, B., Prins, W., Rapp, D., Shields, A., Glass, D. und Superfine, R. (2012). Ein hochgradig abstimmbares magnetisches Elastomer auf Silikonbasis mit nanoskaliger Homogenität. Journal of Magnetism and Magnetic Materials.324(4):501-507. PMC3241051 PMC3241051/PDF

Grooman, B., Fujiwara, I., Otey, C., Upadhyaya, A. (2012)Morphologie und Viskoelastizität von Aktinnetzwerken, die mit den gegenseitig interagierenden Vernetzern gebildet werden: Palladin und Alpha-Aktinin. Plus eins. 7(8):e42773. PMC3420904 PMC3420904/PDF

Haase, J., Stephens, A., Verdaasdonk, J., Yeh, E. und Bloom, K. (2012). Bub1-Kinase und Sgo1 modulieren perizentrisches Chromatin als Reaktion auf eine veränderte Mikrotubuli-Dynamik. Aktuelle Biologie.22(6):471-481.PMC3311747 PMC3311747/PDF

Harter J, Wu, X., Alabi, O., Phadke, M., Pinto, L., Dougherty, D., Petersen, H., Bass, S., & Taylor II, R. Erhöhung der Wahrnehmungspräsenz von Beziehungen in parallelen Koordinatendarstellungen. Proceedings of SPIE Visualization and Data Analysis Januar 2012 Burlingame, California.8294:T1 – T12.PMC3491905 PMC3491905/PDF

Hong, Y., Joshi, S., Sanchez, M., Styner, M., Niethammer, M. (2012). Metamorphische geodätische Regression. Medizinische Bildverarbeitung und computergestützte Intervention (MICCAI).15(Pt 3):197-205. PMC3584322 PMC3584322/PDF

Hong, Y., Shi, Y., Styner, M., Sanchez, M. und Niethammer, M. (2012). Einfache geodätische Regression für Bildzeitreihen. Biomedizinische Bildregistrierung (WBIR).7359:11-20. NIHMS596520 PDF

Jerald J, Whitton, M. und Brooks, F. (2012). Szenenbewegungs-Schwellenwerte während des Kopf-Gierens für immersive virtuelle Umgebungen. ACM-Transaktionen nach Angewandter Wahrnehmung. 9(1). PMC4334481 PDF

Kallemov, B., Miller, G. H., Mitran, S. und Trebotich, D. (2012). Berechnung der viskoelastischen Bead-Rod-Strömung, die durch eine homogenisierte kinetische Skala mit holonomischen Randbedingungen vermittelt wird. Molekulare Simulation.38(10):786-792

Kesimer, M., Ehre, C., Burns, K.A., Davis C.W., Sheehan, J.K., Pickles, R.J. (2012). Molekulare Organisation der Muzine und Glykokalyx, die dem Schleimtransport über die Schleimhautoberflächen der Atemwege zugrunde liegen. Mucosal Immunology.6(2):379-392. PMC3637662 PMC3637662/PDF

Kohli L, Whitton, M. und Brooks, F. (2012). Umgeleitetes Berühren: Die Auswirkung des Warping-Raums auf die Aufgabenleistung. 3D-Benutzeroberflächen (3DUI), IEEE Xplore Digital Library.105-12. PDF

Lam Hui, K., Wang, C., Grooman, B., Wayt, J., &. Upadhyaya, A. (2012)Membrandynamik korreliert mit der Bildung von Signalclustern während der Zellausbreitung. Biophysikalische Zeitschrift. 102(7):1524-1533. PMC 3318117 PMC3318117/PDF

Lee, H., Foskey, M., Niethammer, M., Krajcevski, P., &. Lin, M. (2012). Simulationsbasierte gemeinsame Schätzung von Körperverformungs- und Elastizitätsparametern für die medizinische Bildanalyse. IEEE-Transaktionen zur medizinischen Bildgebung. 31(11):2156-2168. NIHMS555789 PDF

Lessey, E., Guilluy, C. und Burridge, K. (2012). Von der mechanischen Kraft zur RhoA-Aktivierung. Biochemie.51(38):7420-7432.PMC3567302 PMC3567302/PDF

Lewek, M., Feasel, J., Wentz, E., Brooks Jr., F. und Whitton, M. (2012). Verwendung von visuellem und propriozeptivem Feedback zur Verbesserung der Ganggeschwindigkeit und der raumzeitlichen Symmetrie nach einem chronischen Schlaganfall: eine Fallserie. Physiotherapie.92(5):748-756. PMC3345339 PMC3345339/PDF

Lindley, B., Forest, M. G., Smith, B., Mitran, S. und Hill, D. (2012). Räumliche Spannungs- und Dehnungsverteilungen viskoelastischer Schichten bei oszillatorischer Scherung. Mathematik und Computer in der Simulation.82(7):1249-1257.PMC3338131 PMC3338131/PDF

Liu, C., Miller, H., Orlowski, G., Hang, H., Upadhyaya, A., & Song, W. (2012) Die Reorganisation von Aktin ist für die Bildung von polarisierten B-Zell-Rezeptor-Signalosomen als Reaktion auf beide erforderlich lösliche und membranassoziierte Antigene. Zeitschrift für Immunologie. 188(7):3237-3246. PMC3312033 PMC3312033/PDF

Liu, C., Miller, H., Sharma, S., Beaven, A., Upadhyaya, A., & Song, W. (2012)Analyse der Aktindynamik während der Aktivierung des B-Zell-Rezeptors in lebenden B-Zellen. Biochemische und biophysikalische Forschungskommunikation. 427(1):202-206. PMC3499104 PMC3499104/PDF

Miedema, J., Marron, J. S., Niethammer, M., Boland, D., Woosley, J., Coposky, J., Wei, S., Reisner, H. und Thomas, N. E. (2012). Bild- und statistische Analyse der melanozytären Histologie. Histopathology.61(3):436-444.PMC3425719 PMC3425719/PDF

Oldenburg, A., Chhetri, R., Hill, D. B., & Button, B. (2012). Überwachung des Atemwegsschleimflusses und der Ziliaraktivität mit optischer Kohärenztomographie.3(9):1978-1992.PMC3447542 PMC3447542/PDF

Peck T, Fuchs, H und Whitton, M. (2012). Das Design und die Evaluation eines groß angelegten Real-Walking Locomotion Interface. IEEE-Transaktionen zu Visualisierung und Computergrafik. 18(7):1053-67. PMC4091684 PDF

Park, R., Ping, L., Song, J., Hong, S.Y., Choi, T.Y., Choi, J.R., Gorkun, O.V. und Lord, S.T. (2012). Der Fibrinogenrest γAla341 ist für die Calciumbindung und die ‘A-a’-Wechselwirkungen notwendig. Journal of Thrombosis and Haemostasis.107(5):875-883

Phadke, M., Pinto, L., Alabi, F., Harter, J., Taylor II, R., Wu, X., Petersen, H., Bass, S. und Healey, C. Exploring Ensemble Visualization. Proceedings of SPIE Visualization and Data Analysis 2012 Januar 2012 Burlingame, California.8294:(82940B). PMC3278305 PMC3278305/PDF

Roh-Johnson, M., Shemer, G., Higgins, CD, McClellan, JH, Werts, AD, Tulu, USA, Gao, L., Betzig, E., Kiehart, DP und Goldstein, B. (2012) .Auslösen einer Zellformänderung durch Ausnutzung bereits bestehender Actomyosin-Kontraktionen. Science.335(6073)::1232-1235.PMC3298882 PMC3298882

Taylor II, R. und Bloom, K.?Überschneidung von Kunst und Computergrafik? in Visual Strategies von Felice Frankel und Angela H. DePace: ISBN 978-0-300-17644 2012. p. 102-107. Buchkapitel

Cai, L. H., Panyukov, S. und Rubinstein, M. (2011)Mobilität von nichtklebrigen Nanopartikeln in Polymerflüssigkeiten. Makromoleküle. 44(19):7853-7863 PDF

Caplan, J., Niethammer, M., Taylor II R. und Czymmek, K. (2011). Die Kraft der korrelativen Mikroskopie: Multimodal, Multiskalen, Multidimensional. Aktuelle Meinung in der Strukturbiologie.21(5):686-693. PMC3189301 PMC3189301/PDF

Eastwood, B., Mair, L. und Taylor II, R. (2011). Eine strukturierte Beleuchtungsmethode für die Nachführung von Mikroskoptischen. Internationale Konferenz für Bildverarbeitung, Computer Vision und Mustererkennung. 1:201-207. NIHMS325150 „nicht von PMC ausgenommen“ PDF

Evans B., Superfine R. (2011). Designüberlegungen für magnetisch betätigte Zilien. Bionikbasierte Anwendungen (S. 473-498). Anne George (Hrsg.), Rijeka, Kroatien: InTech. Buchkapitel PDF

Feasel, J., Whitton, M., Kassler, L., Brooks, F. und Lewek, M. The Integrated Virtual Environment Rehabilitation Treadmill System. IEEE Transactions on Neural Systems & Amp Rehabilitation Engineering 2011.19(3):290-297. PDF

Finan, J.D., Leddy, H.A., & Guilak, F. (2011)Osmotischer Stress verändert die Chromatinkondensation und den nukleozytoplasmatischen Transport. Biochemische und biophysikalische Forschungskommunikation. 408(2):230-235. PMC3104296 PMC3104296/PDF

Fronczek, D., Quammen, C., Wang, H., Kisker, C., Superfine, R., Taylor II, R., Erie, D., Tessmer, I. (2011). Hochgenaue Fiona-AFM-Hybrid-Bildgebung. Ultramikroskopie.111(5):350-355. PMC3179268 PMC3179268/PDF

Gibbs-Flournoy, E., Bromberg, P., Hofer, T., Samet, J., & Zucker, R. (2011)Darkfield-Confocal Microscopy Detection of Nanoscale Particle Internalization by Human Lung Cells. Partikel- und Fasertoxikologie. 8:2. PMC3033333 PMC3033333/PDF

Guilluy C., Swaminathan, V., Garcia-Mata R., O’Brien, E., Superfine, R., Burridge K. (2011). Die Rho GEFs LARG und GEF-H1 regulieren die mechanische Reaktion auf Krafteinwirkung auf Integrine. Natur Zellbiologie. 2011 Juni 13(6):724-729. PMC3107386 PMC3107386/PDF

Guilluy, C., Garcia,-Mata, R., & Burridge, K. (2011)Rho-Protein-Crosstalk: ein weiteres soziales Netzwerk? Trends in der Zellbiologie. 21 (12): 718-726. PMC3221770 PMC3221770/PDF

Lewis, J., Hembree, W., Furman, B., Tippets, L., Cattel, D., Huebner, J., Little, D., & DeFrate, L. (2011)Akute Gelenkpathologie und Synovialentzündung ist mit einer erhöhten intraartikulären Frakturschwere im Mausknie assoziiert. Arthrose und Knorpel. 19(7):864-873. PMC3312469 PMC3312469/PDF

Liu, C., Miller, H., Hui, KL, Grooman, B., Bolland, S., Upadhyaya, A., & Song, W. (2011) Ein Gleichgewicht von Bruton's Tyrosinkinase und SHIP-Aktivierung reguliert B Zellrezeptor-Clusterbildung durch Kontrolle des Aktin-Remodelings. Zeitschrift für Immunologie. 187(1):230-239. PMC3119787 PMC3119787/PDF

Lozoya O., Wauthier E., Turner R., Barbier C., Prestwich G., Guilak F., Superfine R., Lubkin S., Reid L. Regulation of Hepatic Stem/Progenitor Phenotype by Microenvironment Stiffness in Hydrogel Models of the Nische mit menschlichen Leberstammzellen. Biomaterialien. 32(30):7389-7402. PMC3157321. PMC3157321/PDF

Mair, L.O., Evans, B., Hall, A.R., Carpenter, J., Shields, A., Ford, K., Millard, M., & Superfine, R. (2011). Hoch kontrollierbares oberflächennahes Schwimmen von magnetischen Janus-Nanostäben: Anwendung auf die Erfassung und Manipulation von Nutzlasten. Journal of Physics D: Angewandte Physik. 44(125001). NIHMS337284 PDF

Merkel, T., Jones, S., Herlihy, K., Kersey, F., Shields, A., Napier, M., Luft, J., Wu, H., Zamboni, W., Wang, A., Bear, J., & DeSimone, J. (2011). Verwendung der mechaniobiologischen Mimikry von roten Blutkörperchen zur Verlängerung der Zirkulationszeit von Hydrogel-Mikropartikeln. Proceedings of National Academy of Science.108(2):586-591. PMC3021010 PMC3021010/PDF

Mitran, S., & Young, J. (2011). Multiskalen-Berechnung der Zytoskelett-Mechanik während des Blebbings. Zelluläre und biomolekulare Mechanik und Mechanobiologie.345-371 PDF

Niethammer, M., Hart, G., Pace, D., Vespa, P., Irimia, A., Van Horn, J. und Aylward, S. Geometric Metamorphosis. Konferenz über medizinische Bildverarbeitung und computergestützte Intervention 2011.14:639-646. PMID21995083 PDF

Niethammer, M., Huang, Y., Vialard, F., (2011) Geodesic Regression for Image Time-Series, Conference on Medical Image Computing and Computer Assisted Intervention (MICCAI). 14(Pt 2):655-662. PMID21995085 PDF

Pace, D., Enquobahrie, A., Yang, H., Aylward, S. und Niethammer, M. Deformable Image Registration of Sliding Organs Using Anisotrop Diffusive Regularization. The International Symposium on Biomedical Imaging 2011:407-413.PMC3141338 PMC3141338/PDF

Peck, T., Fuchs, H., & Whitton, M. Eine Bewertung der Navigationsfähigkeit im Vergleich von umgeleiteter freier Erkundung mit Distraktoren zu Walking-in-Place- und Joystick-Locomotion-Schnittstellen. Proceedings of IEEE Virtual Reality 19.-23. März 2011 Singapur:55-62.PMC3268068 PMC3268068/PDF

Ping, L. Huang, L., Cardinali, B., Profumo, A., Gorkun, OV, & Lord, ST, (2011)Substitution der humanen aC-Region durch die analoge Hühnerdomäne erzeugt ein Fibrinogen mit stark beeinträchtigter lateraler Aggregation : Fibrinmonomere lagern sich zu Protofibrillen zusammen, aber Protofibrillen fügen sich nicht zu Fasern zusammen. Biochemie. 50(42(:9066-9075. PMC3203410 PMC3203410

Quammen, C. & Taylor II, R. (2011). Gitter-Voxelisierung mit partiellen Volumeneffekten in VTK. VTK-Zeitschrift. März. NIHMS325155 “von PMC nicht ausgenommen” PDF

Shen, K., Tolbert, C. E., Guilluy, C., Swaminathan, V. S., Berginski, M. E., Burridge, K., Superfine, R. und Campbell, S. L. (2011). Die C-terminale Haarnadel von Vinculin vermittelt die Bildung von F-Aktin-Bündeln, fokale Adhäsion und zellmechanische Eigenschaften. Zeitschrift für biologische Chemie. 286(52):45103-45115. PMC3247952 PMC3247952/PDF

Skarbez, R., Kotranza, A., Brooks, F., Lok, B. und Whitton, M. Eine erste Untersuchung von Gesprächsfehlern als neuartige Methode zur Bewertung virtueller menschlicher Erfahrungen. Proceedings of IEEE Virtual Reality 2011 März 2011 Singapur:243-244 PDF

Spero, R., Sircar, R., Shubert, R., Taylor II, R., Wolberg, A., Superfine, R. (2011). Die Nanopartikeldiffusion misst die Permeabilität von Bulk-Gerinnseln. Biophysikalische Zeitschrift. 101(1-8):943-950. PMC317506 PMC3175063/PDF

Stephens, A., Haase, J., Vicci, L., Taylor II, R. und Bloom, K. (2011). Cohesin, Condensin und die intramolekulare Zentromerschleife bilden zusammen die mitotische Chromatinquelle. Journal of Cell Biology.193(7): 1167-1180. PMC3216333 PMC3216333/PDF

Swaminathan, V., Mythreye, K., O’Brien, E., Berchuck, A., Blobe, G., Superfine, R. (2011). Die mechanische Steifigkeit stuft das Metastasierungspotenzial in Tumorzellen von Patienten und in Krebszelllinien ein. Krebsforschung 71(15):5075-5080. PMC3220953 PMC3220953/PDF

Yemolenko, I.S., Alexander, F., Gorkun, O.V., Lishko, V.K., Lord, S.T., Ros, R., & Ugarova, T.P. (2011)Die Rolle der Alpha-C-Domänen bei der Bildung von nichtadhäsiven Fibrinogenmatrizen. Blut. 118(21):538

Young, J., &. Mitran, S. (2011). Ein kontinuumsmikroskopischer Algorithmus zur Modellierung faseriger, heterogener Medien mit dynamischen Mikrostrukturen. SIAM Multiscale Modeling and Simulation.9(241-256) PDF

Campbell, R., Aleman, M., Gray, L., Falvo, M., &. Wolberg, A. (2010). Fluss beeinflusst tiefgreifend die Struktur des Fibrinnetzwerks: Implikationen für die Fibrinbildung und die Gerinnselstabilität bei der Hämostase. Zeitschrift für Thrombose und Hämostase. 104(6):1281-1284. PMC3236083 PMC3236083/PDF

Carlisle, R.C., Sparks, E.A., Der Loughian, C., & Guthold, M. (2010). Festigkeit und Versagen von Fibrinfaser-Verzweigungspunkten. Journal of Thrombosis and Haemostasis.8(5):1135-1138.PMC3013622 PMC3013622/PDF

Chehetri, R., Carpenter, J., Superfine, R., Randell, S. & Oldenburg, A. (2010). Magnetomotorische optische Kohärenz-Elastographie zum Bezug von Lungenstruktur und -funktion bei Mukoviszidose. Verfahren der SPIE. vol. 7554. PMC3268340 PMC3268340/PDF

Cribb, J., Meehan, T., Shah, S., Skinner, K. und Superfine, R. (2010). Zylinder vs. Kugeln: Biofluid-Scherverdünnung beim angetriebenen Nanopartikeltransport. Annalen der Biomedizinischen Technik. 38(11):3311-3322. PMC3858002 PMC3858002/PDF

Falvo, M., Gorkun, O., & Lord. S. (2010). Die molekularen Ursprünge der mechanischen Eigenschaften von Fibrin. Biophysikalische Chemie. 15.11.(1-3):15-20. PMC2975759 PMC2975759/PDF

Feasel, J., Whitton, M., Kassler, L., Brooks, F. und Lewek, M. The Integrated Virtual Environment Rehabilitation Treadmill System. IEEE Transactions on Neural Systems & Rehabilitation Engineering.19:290-297. PDF

Feng, D., Kwock, L., Lee, Y. und Taylor II, R.M. (2010). Verknüpfte explorative Visualisierungen für unsichere MR-Spektroskopiedaten. Proceedings of the Conference on Visualization and Data Analysis (SPIE).7530:12 Seiten.PMC2997734 PMC2997734/PDF

Feng, D., Lee, Y., Kwock, L. und Taylor II, R. (2010). Abgleich von visueller Salienz mit dem Vertrauen in Diagramme mit unsicheren Daten. IEEE Transactions on Visualization and Computer Graphics (Proceedings Visualization/Information Visualization). 16(6):980-989. PMC3179257 PMC3179257/PDF

Hackney, Z., Mair, L., Skinner, K., Washburn, S. (2010). Photoleitfähigkeit und Polarisationseigenschaften einzelner CdTe-Nanodrähte. Materialbriefe.64(18) 2016-2018. PMC2920430 PMC2920430/PDF

Hall, A.R., An, L., Liu, J., Vicci, L., Falvo, M.R., Superfine, R., Washburn, S. (2010). Experimentelle Messung der Torsionseigenschaften von einwandigen Kohlenstoffnanoröhren. Physical Review Letters.96(25):256102. PMC3274556 PMC3274556/PDF

Hart, G., Shi, Y., Zhu, H., Sanchez, M., Styner, M. und Niethammer, M. (2010). DTI Longitudinal Atlas Building als Durchschnitt der Wachstumsmodelle. Medizinische Bildverarbeitung und computergestützte Intervention, Workshop zur räumlich-zeitlichen Bildanalyse für Längs- und Zeitreihenbilddaten. NIHMS337251 PDF

Hill, D., Swaminathan, V., Estes, A., Cribb, J., O’Brien, E., Davis, C., Boucher, R. & Superfine, R. (2010). Krafterzeugung und Dynamik einzelner Zilien unter externer Belastung. Biophysical Journal 6: 98(1): 57-66. PMC2800978 PMC2800978/PDF

Houser, J., Hudson, N., Ping, L., O’Brien, E., Superfine, R., Lord, S., &. Falvo, M. (2010). Nachweis, dass die &agr;C-Region der Ursprung von niedrigem Modul, hoher Dehnbarkeit und Dehnungsversteifung in Fibrinfasern ist. Biophysikalische Zeitschrift. 99(9):3038-3047. PMC2965937 PMC2965937/PDF

Hudson, N., Houser, J., O’Brien, E., Taylor, R., Superfine, R., Lord, S., &. Falvo, M. (2010). Die Versteifung einzelner Fibrinfasern verteilt die Spannungen gleichmäßig und stärkt die Netzwerke. Biophysical Journal 98(8): 1632-1640. PMC2856168 PMC2856168/PDF

Kassler, L., Feasel, J., Lewek, M., Brooks, F., & Whitton, M. Abgleich der tatsächlichen Laufgeschwindigkeit des Laufbands mit der visuell wahrgenommenen Laufgeschwindigkeit in einer virtuellen Projektionsumgebung. Proceedings of the 7th ACM Symposium on Applied Perception in Graphics and Visualization LosAngeles CA:161-161 PDF

Liu, X., Davis, B., Niethammer, M., Pizer, S., Mageras, G. (2010). Vorhersagegesteuerte Atembewegungsatlasbildung für die bildgeführte 4D-Strahlentherapie in der Lunge. MICCAI, Internationaler Workshop zur Lungenbildanalyse. NIHMS337269 (nicht von PMC akzeptiert) PDF

Liu, W., Carlisle, R.C., Sparks, E.A., & Guthold, M. (2010). Die mechanischen Eigenschaften einzelner Fibrinfasern. Journal of Thrombosis and Haemostasis.8(5):1030-1036.PMC3010862 PMC3010862/PDF

Liu, Y., Lin, X., Upadhyaya, M., Song, Q., & Chen, K. (2010)Intraduktale papilläre muzinöse Neoplasien der Bauchspeicheldrüse: Korrelation von helikalen CT-Merkmalen mit pathologischen Befunden. Europäische Zeitschrift für Radiologie. 76(2):222-227 PDF

Niethammer, M., Borland, D., Marron, S., Woosley, J. und Thomas, N. (2010). Erscheinungsbild-Normalisierung von Histologie-Objektträgern. Medical Image Computing and Computer Assisted Intervention, Workshop on Machine Learning in Medical Imaging.6357:58-66. NIHMS337285 PDF

Nunes, J., Herlihy, K.P., Mair, L.O., Superfine, R., &. DeSimone, J.M. (2010). Multifunktionale, form- und größenspezifische Magneto-Polymer-Verbundpartikel. Nano Letters.10(4):1113-1119.PMC3357060 PMC3357060/PDF

Peck, T., Fuchs, H. & Whitton, M. (2010). Verbesserte Umleitung mit Distraktoren: Ein groß angelegtes Real Walking Locomotion System und seine Auswirkung auf die Navigation in virtuellen Umgebungen. Proceedings of IEEE Virtual Reality 2010 (Waltham, MA März 2010), 35-38. PDF

Quammen, C. & Taylor II, R. (2010). „Anpassung des ITK-Registrierungs-Frameworks an parametrische Bildmodelle“, Kitware Source. (16):9-12. PMC3322640 PMC3322640/PDF

Shields, A. R., Fiser, B. L., Evans, B. A., Falvo, M. R., Washburn, S., &. Superfine, R. Biomimetische Zilien-Arrays erzeugen simultane Pump- und Mischregime. Proceedings of the National Academy of Sciences 7. September 2010.1007:15670-15675.PMC2936597 PMC2936597/PDF

Taylor II, R.M., Jerald, J., VanderKnyff, C., Wendt, J., Borland, D., Marshburn, D., Sherman, W.R., Whitton, M.C. (2010). Lektionen über Softwaresysteme für virtuelle Umgebungen aus 20 Jahren VE-Entwicklung. Präsenz 19(2): 163-178. PMC2887604 PMC2887604/PDF

Wendt, J., Whitton, M.C., &. Brooks, F.B. (2010). GUD WIP: Gait-Understanding-Driven Walking-In-Place.Proceedings of IEEE Virtual Reality 2010 (Waltham, MA März 2010), 51-58. NIHMS599421 PDF

Young, J., &. Mitran, S. (2010). Ein numerisches Modell des zellulären Blebbings. Ein volumenerhaltendes Fluid-Struktur-Interaktionsmodell der gesamten Zelle. Zeitschrift für Biomechanik. (43): 210-220. PMC2813352 PMC2813352/PDF

Campbell, R.A., Overmyer, K.A., Selzman, C.H., Sheridan, B.C., & Wolberg, A.S. (2009). Beiträge extravaskulärer und intravaskulärer Zellen zur Bildung, Struktur und Stabilität von Fibrinnetzwerken. Blut.114(23):4886-4896.PMC2786294 PMC2786294/PDF

Carlisle, C.R., Coulais, C., Namboothiry, M., Carroll, D.L., Hantgan, R.R., & Guthold, M. (2009). Die mechanischen Eigenschaften einzelner, elektrogesponnener Fibrinogenfasern. Biomaterialien.30(6):1205-1213.PMC3012557 PMC3012557/PDF

Chourasia, A., & Taylor II, R. IEEE Visualization 2008 Design Contest. IEEE CG&A Visualization Viewpoints Mai/Juni 2009.29:pp. 86-87

Darling, E. M., P. E. Pritchett, Evans, B., Superfine, R., Zausher, S., & Guilak, F. (2009). Mechanische Eigenschaften und Genexpression von Chondrozyten auf mikrostrukturierten Substraten nach Dedifferenzierung in Monolayer. Zelluläres und molekulares Bioengineering 2(3): 395-404. PMC2898162 PMC2898162/PDF

Dedeugd, C., Wankhede, M., & Sorg, B.S. (2009). Multimodale optische Bildgebung der konvektiven Sauerstofftransportdynamik in Mikrogefäßnetzwerken. Angewandte Optik.48(10):D187-197. PDF

Feng, D., Kwock, L., Lee, Y.Z., & Taylor, R.M. (2009). Bewertung von Glyphen-basierten multivariaten Volumenvisualisierungstechniken. Proceedings of the 6th Symposium on Applied Perception in Graphics and Visualization 2009: 61-68. PMC3087293 PMC3087293/PDF

Fisher, J.K., Ballenger, M., O’Brien, E.T., Haase, J., Superfine, R., & Bloom, K. (2009). DNA-Relaxationsdynamik als Sonde für die intrazelluläre Umgebung. Proceedings of the National Academy of Sciences 106(23): 9250-9255. PMC2695107 PMC2695107/PDF

Fricks, J., Yao, L.X., Elston, T.C., & Forest, M.G. (2009). Zeitbereichsmethoden für den diffusiven Transport in weicher Materie. SIAM Journal on Applied Mathematics.69(5):1277-1308 PDF

Gerardin, E., Chetelat, G., Chupin, M., Cuingnet, R., Desgranges, B., Kim, HS, Niethammer, M., Dubois, B., Lehericy, S., Garnero, L., Eustache , F., Colliot, O., Alzheimer’s Dis Neuroimaging, I. (2009). Die multidimensionale Klassifizierung der Hippocampus-Formmerkmale unterscheidet die Alzheimer-Krankheit und leichte kognitive Beeinträchtigungen vom normalen Altern. Neuroimage.47(4):1476-1486.PMC3001345 PMC3001345/PDF

Ghosh, S., Dutta, S., Gomes, E., Carroll, D., D’Agostino Jr., R., Olson, J., Guthold, M. & Gmeiner, W.H. (2009). Erhöhte Heizeffizienz und selektive thermische Ablation von malignem Gewebe mit DNA-umhüllten mehrwandigen Kohlenstoffnanoröhren. ACS Nano.3(9):2667-2673.PMC2748720 PMC2748720/PDF

Grubb, B.R., Rogers, T.D., Boucher, R.C., &. Ostrowski, L.E. (2009). Ionentransport durch CF und normales murines Geruchs- und Flimmerepithel. American Journal of Physiology – Cell Physiology.296(6):C1301-C1309.PMC2692423 PMC2692423/PDF

Hinczewski, M., Schlagberger, X., Rubinstein, M., Krichevsky, O., Netz, R. R. (2009). Endmonomerdynamik in semiflexiblen Polymeren. Makromoleküle.42(3):860-875.PMC3043606 PMC3043606/PDF

Jerald, J., Steinicke, F., & Whitton, W. Szenenbewegungsschwellen korrelieren mit schrägen Kopfbewegungen für immersive virtuelle Umgebungen. IEEE Fortschritte in der Computer-Mensch-Interaktion 2009:69-75 PDF

Jerald, J. & Whitton, M. (2009). Verknüpfung von Szenenbewegungsschwellenwerten mit Latenzschwellenwerten für Head-Mounted Displays. Proceedings of IEEE Virtual Reality Lafayette, LA. 211-218 März. PMC3095496 PMC3095496/PDF

Jerald, J. Szeneninstabilität während der Kopfdrehung. Proceedings of IEEE VR Workshop on Perceptual Illusions in Virtual Environments 2009 Lafayette, LA PDF

Kaplan, E., Min, J.-Y., Ke, Q., Chen, Y., Niethammer, M., Rana, J.S., Malek, S., Verheugt, F.W.A., & Morgan, J.P. (2009). Calcium und zyklische Nukleotide beeinflussen die TNF-alfa-induzierte Stammzellmigration. Biochemical and Biophysical Research Communications.382:241-246.PMC2941773 PMC2941773

Kohli, L. Nutzung von Wahrnehmungsillusionen zur Verbesserung der passiven Haptik. IEEE VR Workshop zu Wahrnehmungsillusionen in virtuellen Umgebungen 2009 Lafayette, LA PDF

Levitt, JJ, Styner, M., Niethammer, M., Bouix, S., Koo, MS, Voglmaier, MM, Dickey, CC, Niznikiewicz, MA, Kikinis, R., McCarley, RW, Shenton, ME (2009) . Formanomalien des Nucleus caudatus bei schizotypischer Persönlichkeitsstörung.Schizophrenie-Forschung.110(1-3):127-139.PMC2756791 PMC2756791/PDF

Lindley, B., Howell, E.L., Smith, B.D., Rubinstein, G.J., Forest, M.G., Mitran, S.M., Hill, D.B. & Superfine, R. (2009). Stresskommunikation und Filterung viskoelastischer Schichten bei oszillatorischer Scherung. Journal of Non-Newtonian Fluid Mechanics 156(1-2): 112-120. PDF

Livraghi, A., Grubb, B.R., Hudson, E.J., Wilkinson, K.J., Sheehan, J.K., Mall, M.A., O’Neal, W.K., Boucher, R.C. & Randell, S.H. (2009). Atemwegs- und Lungenpathologie aufgrund von Austrocknung der Schleimhautoberfläche in -epitheliale Na+-Kanal-überexprimierende Mäuse: Rolle von TNF- und IL-4R Signalübertragung, Einfluss der neonatalen Entwicklung und begrenzte Wirksamkeit der Glukokortikoid-Behandlung. Die Zeitschrift für Immunologie. 182(7):4357-4367. PMC2659461 PMC2659461/PDF

Macenko, M., Niethammer, M., Marron, J. S., Borland, D., Woosley, J. T., Guan, X., Schmitt, C. & Thomas, N. E. (2009). Eine Methode zur Normalisierung von Histologie-Objektträgern für die quantitative Analyse. Internationales Symposium zur biomedizinischen Bildgebung.1107-1110

Mair, L., Ford, K., Alam, R., Kole, R., Fisher, M. und Superfine, R. (2009). Partikel mit einheitlicher Größe von 200 nm: Herstellung und Anwendung bei der Magnetofektion. Zeitschrift für biomedizinische Nanotechnologie 5: 182-191. PMC2818021 PMC2818021/PDF

Mair, L., Skinner, K., Donley, C. L., Superfine, R. (2009). Galvanisch abgeschiedene Au-CdTe-Au-Nanodrähte: lösungsbasierte Kontrolle der Cd/Te-Stöchiometrie. Transaktionen der Elektrochemischen Gesellschaft (19(3)): 99-109.

McKinley, S., Yao, L., & Forest, M. (2009). Transiente anomale Diffusion von Tracer-Partikeln in weicher Materie. Zeitschrift für Rheologie. (53):1487-1506 PDF

Niethammer, M., Zach, C., Melonakos, J., Tannenbaum, A. (2009). Segmentierung von röhrennahen Faserbündeln für die diffusionsgewichtete Bildgebung: Segmentierung durch Rahmenneuausrichtung. Neuroimage.45(1):S123-S132.PMC2774769 PMC2774769/PDF

Peck, T.M., Fuchs, H., & Whitton, M.C. (2009). Bewertung von Neuorientierungstechniken und Distraktoren für das Gehen in großen virtuellen Umgebungen. Transaktionen über Visualisierung und Computergrafik 15(3): 383-394. PMC2844119 PMC2844119/PDF

Peck, T., Fuchs, H., & Whitton, M.C. (2009). Verbesserte Umleitung mit Distraktoren: Ein groß angelegtes Real Walking Locomotion System und seine Auswirkung auf die Navigation in virtuellen Umgebungen. Virtual-Reality-Konferenz (VR) IEEE.35-38 PDF

Quammen, C., Feng, D., & Taylor II, R.M. Leistung von 3D-Entfaltungsalgorithmen auf Multi-Core- und Many-Core-Architekturen. UNC-Chapel Hill Department of Computer Science Technical Report.TR-09-001 PDF

Reuter, M., Wolter, F. E., Shenton, M., Niethammer, M. (2009). Laplace-Beltrami-Eigenwerte und topologische Merkmale von Eigenfunktionen für die statistische Formanalyse. Computer-Aided Design.41(10):739-755.PMC2753296 PMC2753296/PDF

Taylor II, RM, Robinett, W., Chi, VL, Brooks Jr., FP, Wright, WV, Williams, RS, Snyder, RJ, Chen, J., Okimoto, S., Llopis-Artime, N., Falvo , M., Paulson, S., Thiansathaporn, P., Glick, D., Washburn, S., Superfine, R., Jen, D., Parente, P., Robbins, J., Weigle, C., Burette , A., Weinberg, R., Varadhan, G., &. Erie, D. Computerintegrierte Systeme für Mikroskopie und Manipulation. IEEE VisWeek 2009 Discovery Exhibition 2009: 2 Seiten PDF

Voineskos, AN, O’Donnell, LJ, Lobaugh, NJ, Markant, D., Ameis, SH, Niethammer, M., Mulsant, BH, Pollock, BG, Kennedy, JL, Westin, CF, Shenton, ME (2009) . Quantitative Untersuchung einer neuartigen Clustering-Methode mittels Magnetresonanz-Diffusionstensor-Traktographie. Neuroimage.45(2):370-376.PMC2646811 PMC2646811/PDF

Wirtz, D. (2009)Partikel-Tracking-Mikrorheologie lebender Zellen: Prinzipien und Anwendungen. Jährliche Überprüfung der Biophysik. 38.301-326 PDF

Zach, C., Niethammer, M., & Frahm, J.M. (2009). Kontinuierliche maximale Flüsse und Wulff-Formen: Anwendungen auf MRFs. Proceedings of the Conference on Computer Vision and Pattern Recognition (CVPR).1911-1918 PDF

Zach, C., Shan, L., &. Niethammer, M. (2009). Global optimale Finsler Aktivkonturen. Tagungsband des Symposiums Mustererkennung der Deutschen Gesellschaft für Mustererkennung (DAGM).5748:552-561 PDF

Zhang L, B. B., Gabriel SE, Burkett S, Yan Y, Skiadopoulos MH, Dang YL, Vogel LN, McKay T, Mengos A, Boucher RC, Collins PL, Pickles RJ. (2009). Die CFTR-Lieferung an 25 % der Oberflächenepithelzellen stellt die normalen Geschwindigkeiten des Schleimtransports in das Epithel der Atemwege bei zystischer Fibrose beim Menschen wieder her. PLOS Biologie. (7).PMC2705187 PMC2705187/PDF

Button, B., Boucher, R.C. (2008). Rolle von mechanischem Stress bei der Regulierung der Oberflächenhydratation der Atemwege und der Schleim-Clearance-Raten. Respir Physiol Neurobiol.163(1-3):189-201. PMC2645865

Cakici, S. S. Sezerman, U., & Balcisoy, S. (2008) DockPro: Ein VR-basiertes Werkzeug für Protein-Protein-Docking-Probleme. Das internationale Journal für Virtual Reality. 8(Ausgabe 2-2009/4): 19-23.

Campbell, R. A., Overmyer, K. A., Bagnell, C. R., & Wolberg, A.S. (2008)Zelluläre prokoagulierende Aktivität diktiert die Gerinnselstruktur und -stabilität als Funktion des Abstands von der Zelloberfläche. Arteriosklerose, Thrombose und Gefäßbiologie. 28(12):2247-2254. PMC2773697
Publikation PMC2773697

Davis, C.W., & Lazarowski, E. (2008). Kopplung der Ziliaraktivität der Atemwege und der Muzinsekretion an mechanische Belastungen durch purinerge Signalübertragung. Atemphysiologie Neurobiologie. (163):1-3. PMC2583098

Davis, C. W. & Dickey, B. F. (2008)Regulierte Atemwegsbecherzell-Mucinsekretion. Jährliche Überprüfung der Physiologie. 70:487-512.
Veröffentlichung 17988208

Desai, KV, Bishop, TG, Vicci, L., O’Brien, ET, Taylor II, R., & Superfine, R. (2008)Agnostisches Partikeltracking für die dreidimensionale Bewegung von Zellgranulaten und membrangebundene Bead-Dynamik . Biophysikalisches Journal. 94(6): p. 2374-84. PMC2257905

Desprat, N., Supatto, W., Pouille, P.A., Beaurepaire, E., & Farge, E. (2008)Gewebedeformation moduliert die Twist-Expression, um die Differenzierung des vorderen Mitteldarms in Drosophila-Embryonen zu bestimmen. Entwicklungszelle. 15(3):470-477.

Falvo, M. R., Millard, D., O’Brien, E.T., Superfine, R., & Lord, S.T. (2008)Die Länge der Tandem-Wiederholungen in der alphaC-Region von Fibrin korreliert mit der Faserdehnbarkeit. Zeitschrift für Thrombose und Hämostase. 2008. PMC2655637

Feasel, J., M. C. Whitton und J. D. Wendt. LLCM-WIP: Niedrige Latenz, Kontinuierliche -Bewegungs-Walking-In-Place. Proceedings of IEEE Symposium on 3D User Interfaces. 2008. 97-104.

Feng, D., Y. Lee, L. Kwock und Taylor R.M. ii. Multivariate skalare Volumenvisualisierung zur Beziehungs- und Wertschätzung. Transaktionen zu Visualisierung und Computergrafik. 2008.

Hohenegger, C., Wald, M. (2008). Zwei-Bead-Mikrorheologie: Modellierungsprotokolle. Physische Überprüfung. E, Statistische, nichtlineare und weiche Materiephysik.78(3 Pt 1):031501.PMC2692253

Huang, B., Jones, S. A., Brandenburg, B., &. Zhuang, X. (2008) Whole-cell 3D STORM zeigt Wechselwirkungen zwischen zellulären Strukturen mit einer Auflösung im Nanometerbereich. Natur Methoden. 5(12)1047-1052. PMC2596623
Publikation PMC2596623

Jerald, J., T. M. Peck, F. Steinicke und M. Whitton. Empfindlichkeit gegenüber Szenenbewegungen für Phasen des Kopfgierens. Proceedings of Applied Perception in Graphics and Visualization. 2008.

Kharlampieva, E., Ankner, J. F., Rubinstein, M., &. Sukhishvili, S. A. (2008) pH-induzierte Freisetzung von Polyanionen aus mehrschichtigen Filmen. Physische Überprüfungsbriefe. 100 (12):128303

Kreda, S., Boucher, R. C., Lazarowski, E. (2008). Nukleotidfreisetzung und epitheliale Physiologie der Atemwege. Physiologische Nachrichten. (71):19-22

Lan, Y., Elston, T.C., &. Papoian, G.A. (2008)Eliminierung schneller Variablen in chemischen Langevin-Gleichungen. Die Zeitschrift für Chemische Physik. 129(21):214115. PMC2674792

Lloyd, B., Govindaraju, N., Quammen, C., Molnar, S., Manocha, D. (2008) Logarithmische Perspektivische Schattenkarten. ACM-Transaktionen von Grafiken. 27(4)

Mihalik, J. P., L. Kohli und M. C. Whitton. Kontraindizieren die physikalischen Eigenschaften eines Virtual-Reality-Geräts seine Verwendung für die Gleichgewichtsbeurteilung? Zeitschrift für Sportrehabilitation. 2008. 17(1): p. 38-49.

Mitran, S., M. G. Forest, B. Lindley, L. Yao und D. B. Hügel. Erweiterungen des Ferry-Scherwellenmodells für die aktive lineare und nichtlineare Mikrorheologie. Nicht-Newtonsche Strömungsmechanik. 2008. PMC2790219

Nie, Z., Fava, D., Rubinstein, M., & Kumacheva, E. (2008) “Supermolecular”assembl of gold nanorods endterminated with plymer “pom-poms”: effect of pom-pom Struktur auf den Assoziationsmodi. Zeitschrift der American Chemical Society. 130(11):3683-3689.

O’Brien, E.T., 3., M.R. Falvo, D. Millard, B. Eastwood, R.M. Taylor, 2. und R. Superfein. Ultradünne selbstorganisierte Fibrinplatten. Proc Natl Acad Sci U S A. 2008. 105(49): p. 19438-43. PMC2614779

O’Brien, E.T., J. Cribb, D. Marshburn, R.M. Taylor, 2. und R. Superfein. Kapitel 16: Magnetische Manipulation für Kraftmessungen in der Zellbiologie. Methoden Cell Biol. 2008. 89: P. 433-50.

Peck, T. M., M. C. Whitton und H. Fuchs, Evaluation of Reorientation Techniques for Walking in Large Virtual Environments, in Proceedings of IEEE Virtual Reality. 2008: Reno, NV. P. 121-127.

Quammen, C. W. und R. M. Taylor II. Titelbild auf Current Biology. 2008.

Quammen, C. W., Richardson, A. C., Haase, J., Harrison, B. D., Taylor, R. M., & Bloom, K. S. (2008) FluoroSim: A Visual Problem-Solving Environment for Fluorescence Microscopy, in Verfahren der Eurographics Workshop zu Visual Computing für die Biomedizin, Delft, Niederlande, 6.-7. Oktober 2008, S. 151–158. PMC2860625

Shusharina, N.P., &. Rubinstein, M. (2008 Concentration Regimes in solutions of polyelectrolyte stars. Macromolecules. 41(1):203-217.

Sonnenwald, D. H., M. C. Whitton und K. Maclaughlin, Evaluation of a Scientific Collaboratory System: Investigation a Collaboratorys Potential before Deployment, in Wissenschaft im Internet, G. Olson, A. Zimmerman und N. Bos, Herausgeber. 2008, MIT-Presse: Boston.

Spero, R. C., L. Vicci, J. Cribb, D. Bober, V. Swaminathan, E. T. O’Brien, S.L. Rogers und R. Superfein. Hochdurchsatzsystem zur magnetischen Manipulation von Zellen, Polymeren und Biomaterialien, Polymeren und Biomaterialien. Rev Sci Instrument. 2008. 79(8): p. 083707. PMC2748383

Spero, R., & Taylor II, R. (2008) Skalare Potentialtopographie kann die Interpretation von 2D-Vektorfeldern vereinfachen. Technischer Bericht der UNC Informatik.

Spero, R.C., Wolberg, A., Lord, S., & Superfine, R. (2008). “High-Throughput-Screening von Fibringerinnseln: Transport und Mechanik mit Mikrokügelchen gemessen.” Blutabstracts.

Superfine, R., Swaminathan, V., O’Brien, E.T., Boucher, R., Button, B., &Amp. Estes, A. Stall Force and Response of Lung Cilia. American Physical Society, APS-Märztagung 2008. 2008.

Taylor, A.C. u. R. (2009). Designwettbewerb für IEEE-Visualisierung 2008. IEEE CG&A-Visualisierungsansichten. vol. 29, Nr. 3: S. 86-87.

Taylor, R.C.S. u. R. M. (2008). “Skalare Potentialtopographie kann die Interpretation von 2D-Vektorfeldern vereinfachen.” Technischer Bericht der UNC Informatik #RT08-008.

Taylor, R.M., 2. (2008). Haptik für die wissenschaftliche Visualisierung. Haptisches Rendering: Grundlagen, Algorithmen und Anwendungen. M. Lin und M. Otaduy, A. K. Peters LTD.

Visnapuu, M. L., Fazio, T., Wind, S., & Greene, E. C. (2008)Parallele Arrays geometrischer Nanowells zum Zusammenbauen von DNA-Vorhängen mit kontrollierter lateraler Dispersion. Langmuir. 24(19):11293-11299. PMC2748852

Whitton, M. C. und S. Razzaque, Fortbewegung, in HCI Jenseits der GUI: Design für Haptik, Sprache, Geruch und andere nicht-traditionelle Schnittstellen, P. Kortum, Herausgeber. 2008, Morgan Kaufmann: Burlington, MA. P. 107-146.

Whitton, M. und F. Brooks, Bewertung von VE Component Technologies, in VE-Komponenten und Trainingstechnologien, D. Nicholson, J. Cohn und D. Schmorrow, Herausgeber. im Druck, Praeger Security International: Westport, CN.

Whitton, M. und J. D. Wendt (2008). Modellieren und Rendern. Virtuelle Umgebungen für Aus- und Weiterbildung: Entwicklungen für das Militär und darüber hinaus. D. Nicholson, D. Schmorrow und J. Cohen. Westport, CN, Praeger Security International. 2: 15-20.

Whitton, M. und Loftin, R.B., Abschnitt Perspektive: Virtual Environment Component Technologies, in VE-Komponenten und Trainingstechnologien, D. Nicholson, J. Cohn und D. Schmorrow, Herausgeber. im Druck, Praeger Security International: Westport, CN.

Wong, O.K., Guthold, M., Erie, D.A., & Gelles, J. (2008)Interconvertible Lac Repressor-DNA Loops Revealed by Single-Molecule Experiments. PLoS Biologie. 6(9):e232. PMC2553838

Zach, C, Gallup, D., Frahm, J. M., Niethammer, M. Schnelles globales Labeling für Echtzeit-Stereo mit mehreren Ebenen-Sweeps. Vision, Modellierung und Visualisierung Workshop 2008.

Zuo, P., Picher, M., Okada, S.F., Lazarowski, E.R., Button, B., Boucher, R.C., Elston, T.C. (2008). Mathematisches Modell der Nukleotidregulation auf Atemwegsepithelien. Auswirkungen auf die Homöostase der Atemwege. Zeitschrift für biologische Chemie. 283(39):26805-26819. PMC2546543

Abdullah, L. H. und C. W. Davis. Regulierung der Schleimhautsekretion der Atemwegsbecherzellen durch Tyrosin-Phosphorylierungs-Signalwege. Am J Physiol Lungenzelle Mol Physiol. 2007. 293(3): p. L591-9.

Borland, D. und M. R. Taylor, 2. Regenbogenfarbenkarte (noch) als schädlich angesehen. IEEE Comput Graph-App. 2007. 27(2): p. 14-7.

Boucher, R. C. Hinweise auf eine Dehydratation der Atemwegsoberfläche als auslösendes Ereignis der CF-Atemwegserkrankung. J Praktikant Med. 2007. 261(1): p. 5-16.

Boucher, R. C. Dehydration der Atemwegsoberfläche bei Mukoviszidose: Pathogenese und Therapie. Annu Rev Med. 2007. 58: P. 157-70.

Boucher, R. C. Mukoviszidose: eine Erkrankung der Anfälligkeit für eine Austrocknung der Atemwegsoberfläche. Trends Mol Med. 2007. 13(6): p. 231-40.

Boucher, R. C. Hinweise auf eine Dehydratation der Atemwegsoberfläche als auslösendes Ereignis der CF-Atemwegserkrankung. J Praktikant Med. 2007. 261(1): p. 5-16.

Bouzarth, E. L., A. Brooks, R. Camassa, H. Jing, T.J. Leitermann, R. M. McLaughlin, R. Superfine, J. Toledo und L. Vicci. Epizyklische Bahnen in einer viskosen Flüssigkeit um einen präzessierenden Stab: Theorie und Experimente auf der Mikro- und Makroskala. Phys Rev E Stat Nonlin Weiche Materie Phys. 2007. 76(1 Pkt 2): S. 1 016313.

Burette, A., D. Feng, D. Marshburn, D. Jen, R. Weinberg und R.M.T. II. ToolBox: Der Schritt in die dritte Dimension. Zeitschrift für Neurowissenschaften. 2007. 27: P. 12757 – 12760.

Burns, E., S. Razzaque, M. Whitton und F. Brooks. MACBETH: Der Avatar, den ich vor mir sehe und seine Bewegung in Richtung meiner Hand (Poster Abstract). in IEEE Virtuelle Realität 2007. 2007. Charlotte, NC: IEEE.

Button, B., M. Picher und R.C. Boucher. Unterschiedliche Auswirkungen von zyklischem und konstantem Stress auf die ATP-Freisetzung und den mukoziliären Transport durch menschliche Atemwegsepithelien. J Physiol. 2007. 580(Teil 2): ​​p. 577-92.

Cribb, J., D. Hill, R.M. Taylor II, L. Vicci, J.K. Fisher, K. Desai, M.G. Forest und R. Superfine. Nichtlineare Rheologie verschränkter Lambda-DNA-Lösungen über getriebene Mikrobead-Rheologie. in Jahrestreffen der Biophysikalischen Gesellschaft. 2007. Baltimore, MD.

Cribb, J., B. David, R.M. Taylor, L. Vicci, J. Fisher, K. V. Desai, M. G. Forest und R. Superfine. Nichtlineare Rheologie verschränkter Lambda-DNA-Lösungen durch getriebene Mikrobead-Rheologie. Biophysikalisches Journal. 2007: s. 638A-638A.

Desai, K. V., E. T. O’Brien, J. Cribb und R. Superfine. Zelluläre Nichtlineare Kriechreaktion hängt von der Membranverankerung ab: eine Magnetkraftstudie. in Treffen der Biophysikalischen Gesellschaft. 2007. Baltimore, Maryland: Biophysikalisches Journal.

Desai, K. V., E. T. O’Brien, J. Cribb und R. Superfine. Zelluläre Nichtlineare Kriechreaktion hängt von der Membranverankerung ab: eine Magnetkraftstudie. Biophysikalisches Journal. 2007: s. 420a-420a.

Eastwood, B. und R.M. Taylor. Okklusionsentfernung in der Videomikroskopie. Computeranalyse von Bildern und Mustern, Springer Berlin. 2007. 4673: P. 125�.

Evans, B. A., A. R. Shields, R. L. Carroll, S. Washburn, M. R. Falvo und R. Superfine. Magnetisch betätigte Nanostab-Arrays als biomimetische Zilien. Nano Lett. 2007. 7(5): s. 1428-34.

Feng, D., D. Marshburn, D. Jen, R.J. Weinberg, R. M. Taylor, 2. und A. Burette. Schritt in die dritte Dimension. J Neurowissenschaft. 2007. 27(47): p. 12757-60.

Fisher, J. K., L. Vicci, K. Bloom, E. T. O’Brien, C. W. Davis, R. M. Taylor II und R. Superfine, Magnetic Manipulation for the Biomedical Sciences, in Handbuch der Nanowissenschaften, Ingenieurwissenschaften und Technologie, zweite Auflage. 2007, CRC Press LLC: Boca Raton.

Glencross, M., C. Jay, J. Feasel, L. Kohli, M. C. Whitton und R. Hubbold. Effektive kooperative haptische Interaktion über das Internet. in Proceedings of IEEE Virtual Reality 2007. 2007.

M. Guthold, W. Liu, EA Sparks, LM Jawerth, L. Peng, M. Falvo, R. Superfine, RR Hantgan, ST Lord (2007) „Ein Vergleich der mechanischen und strukturellen Eigenschaften von Fibrinfasern mit anderen Proteinfasern ” Zellbiochemie und Biophysik 49, 165-181.

Guthold, M., W. Liu, E.A. Sparks, L. M. Jawerth, L. Peng, M. Falvo, R. Superfine, R. R. Hantgan und S. T. Herr. Ein Vergleich der mechanischen und strukturellen Eigenschaften von Fibrinfasern mit anderen Proteinfasern. Cell Biochem Biophys. 2007. 49(3): p. 165-81.

Hall, A. R., M. R. Falvo, R. Superfine und S. Washburn. Elektromechanische Reaktion einwandiger Kohlenstoff-Nanoröhrchen auf Torsionsdehnung in einem in sich geschlossenen Gerät. Natur Nanotechnologie. 2007. 2: P. 413-416.

Hickey, A. J., H. M. Mansour, M. J. Telko, Z. Xu, H. D. Smyth, T. Mulder, R. McLean, J. Langridge und D. Papadopoulos. Physikalische Charakterisierung von Komponentenpartikeln, die in Trockenpulverinhalatoren enthalten sind. I. Strategieüberprüfung und statische Merkmale. J Pharm Wissenschaft. 2007. 96(5): s. 1282-301.

Hirsh, A. J., J. R. Stonebraker, C. A. van Heusden, E. R. Lazarowski, R. C. Boucher und M. Picher. Adenosindeaminase 1 und die konzentrierten Nukleosidtransporter 2 und 3 regulieren Adenosin auf der apikalen Oberfläche des menschlichen Atemwegsepithels: Implikationen für entzündliche Lungenerkrankungen. Biochemie. 2007. 46(36): p. 10373-83.

Jerald, J., A. Fuller, A. Lastra, M.C. Whitton, L. Kohli und F. P. Bäche. Latenzkompensation durch horizontale Scanline-Auswahl für Head-Mounted-Displays. in Proceediings of SPIE Vol 6490 Stereoskopische Displays und Virtual Reality Systeme. 2007.

Kreda, S. M., S. F. Okada, C. A. van Heusden, W. O’Neal, S. Gabriel, L. Abdullah, C. W. Davis, R. C. Boucher und E. R. Lazarowski. Koordinierte Freisetzung von Nukleotiden und Mucin aus humanen epithelialen Calu-3-Zellen der Atemwege. Zeitschrift für Physiologie. 2007. 584(Teil 1): p. 245-59. PMC2277076

Liu, W., Bonin, K. Guthold, M. (2007) „Eine einfache und direkte Methode zur Kalibrierung von AFM-Querkraftmessungen“ Review of Scientific Instruments 78, 063707 (7 Seiten)

Mitran, S. Computermodell der mukoziliären Clearance – Therapierelevanz. Pädiatrische Pneumologie. 2007: s. 111-112.

Mitran, S. M. Metachrone Wellenbildung in einem Lungenzilienmodell. Rechenstruktur. 2007. 85(11-14): p. 763-774.

O’Brien, E.T., III, B. Wilde, S. Massenburg, K. Desai, R.M. Taylor, II, D. Marshburn und R. Superfine. Zelluläre Nichtlineare Kriechreaktion hängt von der Membranverankerung ab: eine Magnetkraftstudie. in Treffen der Biophysikalischen Gesellschaft. 2007. Baltimore, Maryland: Biophysikalisches Journal.

Peng, L., Stephens, B.J., Bonin, K., Cubicciotti, R., Guthold, M., (2007) „NanoSelection® – ein Roman, Einzel-Zyklus-Methode zur Auswahl Individuell Aptamerspezies aus einem kleinen Pool zufälliger Oligonukleotide” Mikroskopieforschung und -technik 70, 372-381

Peng, L., B. J. Stephens, K. Bonin, R. Cubicciotti und M. Guthold. Eine kombinierte Rasterkraft-/Fluoreszenz-Mikroskopie-Technik, um Aptamere in einem einzigen Zyklus aus einem kleinen Pool zufälliger Oligonukleotide auszuwählen. Microsc Res Tech. 2007. 70(4): p. 372-81.

Rubinstein, M. Polymerphysik der Perziliarschicht. Pädiatrische Pneumologie. 2007: s. 112-113.

Sears, P. R., K. Thompson, M. R. Knowles und C. W. Davis. Empirisches Modell der Ziliardynamik für humanes Atemwegsepithel. Biophysikalisches Journal. 2007: s. 486A-486A.

Schilde, A. R. Magnetisch betätigte Nanostäbchen-Arrays als biomimetische Silia. Nano-Buchstaben. 2007. 7(5): s. 1428-1434.

Spero, R. C., B. Smith, L. Vicci, J. Cribb, E. T. O’Brien, S.T. Herr und R. Superfein. Mikrokügelchen-Rheologie von Fibrin-Gelen mit hohem Durchsatz. in Treffen der Biophysikalischen Gesellschaft. 2007. Baltimore, Maryland: Biophysikalisches Journal.

Spero, R. C., B. Smith, L. Vicci, J. Cribb, E. T. O’Brien, S.T. Herr und R. Superfein. Microbead-Rheologie von Fibringele mit hohem Durchsatz. Biophysikalisches Journal. 2007: s. 521a-521a.

Sun, F. C., A. V. Dobrynin, D. Shirvanyants, H.I. Lee, K. Matyjaszewski, G.J. Rubinstein, M. Rubinstein und S. S. Sheiko. Flory-Theorem für strukturell asymmetrische Mischungen. Physische Überprüfungsschreiben. 2007. 99(13).

Tanase, M., N. Biais und M. Sheetz. Magnetpinzetten in der Zellbiologie. Methoden Cell Biol. 2007. 83: P. 473-93.

Winters, S. L., C. W. Davis und R. C. Boucher. Mechanosensibilität der trachealen Ziliarschlagfrequenz der Maus: Rollen für Ca2+, purinerge Signalübertragung, Tonizität und Viskosität. Am J Physiol Lungenzelle Mol Physiol. 2007. 292(3): p. L614-24.

Xu, K., M.G. Wald, und ich. Klapper. Zur Korrespondenz zwischen kriechenden Strömungen viskoser und viskoelastischer Flüssigkeiten. Zeitschrift für Nicht-Newtonsche Strömungsmechanik. 2007. 145(2-3): p. 150-172.

Asokan, S., R. L. Caroll, S. Washburn, R. E. Cheney und R. Superfine. Der Flüssigkeitsfluss kann bewegliche Aktinfilamente in mikrofluidischen Kanälen steuern. Biophysikalisches Journal. 2006.

Burns, E. und F. P. Brooks Jr. Wahrnehmungsempfindlichkeit für visuelle / kinästhetische Diskrepanzen in der Handgeschwindigkeit und warum wir uns interessieren könnten. in VRST 2006. 2006. Simassol, Zypern.

Burns, E., S. Razzaque, A.T. Panter, M. C. Whitton, M. R. McCallus und F. P. Brooks Jr. Die Hand lässt sich leichter täuschen als das Auge: Benutzer reagieren empfindlicher auf visuelle gegenseitige Durchdringung als auf visuell-propriozeptive Diskrepanzen. Journal on Presence: Teleoperators and Virtual Environments. 2006. 15(1): p. 1-15.

Burns, E., S. Razzaque, M.C. Whitton und F. P. Bäche. MACBETH: Manadement of Avatar Conflict durch Einsatz eines Technik-Hybrids. Internationale Zeitschrift für virtuelle Realität. 2006. 6(2): P. 11-20. Verbrennungen2006

Cribb, J., D. B. Hill, J. Fisher, J. Sheehan, M. Rubinstein, M.G. Forest und R. Superfine. Kontrast und Vergleich der mikroskopischen und makroskopischen rheologischen Eigenschaften von Lambda-DNA und menschlichem Atemwegsschleim. Biophysikalisches Journal. 2006.

Fielding, J. R., D. Borland, K. H. Lee, J. P. Clarke, E. Wallen, R. Pruthi und R. M. Taylor. Virtuelle Pyeloskopie mit volumetrischem Tiefenpeeling. Acad Radiol. 2006. 13(6): p. 759-63.

Fisher, J. K., J. Cribb, K. V. Desai, L. Vicci, B. Wilde, K. Keller, R.M. Taylor, J. Haase, K. Bloom, E.T. O’Brien und R. Superfine. Dünnfolien-Magnetkraftsystem für die Mikroskopie mit hoher numerischer Apertur. Rev Sci Instrument. 2006. 77(2):

Fisher, J. K., L. Vicci, J. Cribb, E. T. O’Brien, R.M. Taylor und R. Superfein. Magnetkraft-Mikromanipulationssysteme für die biologischen Wissenschaften. NANO. 2006. 1(3): p. 191-205.

Hall, A. R., L. An, J. Liu, L. Vicci, M. R. Falvo, R. Superfine und S. Washburn. Experimentelle Messung der Torsionseigenschaften von einwandigen Kohlenstoffnanoröhren. Phys Rev Lett. 2006. 96(25): p. 256102.

Jones, M. G., M. R. Falvo, B. P. Broadwell und S. Dotger. Selbstorganisation – Wie die Natur baut. Der Lehrer für Naturwissenschaften. 2006.

Klapper, I., K. Xu und M.G. Wald. Reziprozitätsbeziehungen zwischen Stokes-Strömungen von viskosen und viskoelastischen Flüssigkeiten. Zeitschrift für Nicht-Newtonsche Strömungsmechanik. 2006.

Liu, W., Jawerth, L. M., Sparks, E. A., Falvo, M. R., Hantgan, R. R., Superfine, R., Lord, S. T., Guthold, M., (2006) „Fibrinfasern haben außergewöhnliche Dehnbarkeit und Elastizität“ Wissenschaft 313, 634

Liu, W., L. M. Jawerth, E. A. Sparks, M. R. Falvo, R. R. Hantgan, R. Superfine, S. T. Herr und M. Guthold. Fibrinfasern haben eine außergewöhnliche Dehnbarkeit und Elastizität. Wissenschaft. 2006. 313(5787): p. 634.

Martin, J., Prozedurale Hausgenerierung: Eine Methode zur dynamischen Generierung von Grundrissen (Poster), 2006 ACM Symposium on Interactive 3D Graphics and Games. 2006, ACM: Redwood City, CA.

Matsui, H., V. E. Wagner, D. B. Hill, Vereinigte Staaten von Amerika Schwab, T. D. Rogers, B. Button, R. M. Taylor, 2., R. Superfine, M. Rubinstein, B.H. Iglewski und R. C. Boucher. Eine physikalische Verbindung zwischen der Dehydratation der Atemwegsoberfläche bei Mukoviszidose und Pseudomonas aeruginosa-Biofilmen. Proc Natl Acad Sci U S A. 2006. 103(48): p. 18131-6.

Muller, P., J. Cohn, D. Schmorrow, R. Stripling, K. Stanney, L. Milham, M.C. Whitton und J. Folks. Die Fidelity-Matrix: Zuordnung der System-FIdelity zum Trainingsergebnis. in Verfahren der IITSEC 2007. 2006.

Peng, L., B. J. Stephens, K. Bonin, R. Cubicciotti und M. Guthold. Eine kombinierte Rasterkraft-/Fluoreszenzmikroskopie-Technik zur Selektion von Aptameren in einem einzigen Zyklus aus einem kleinen Pool zufälliger Oligonukleotide. Mikroskopieforschung und -technik. 2006.

Prakash, R., R. Superfine, S. Washburn und M. R. Falvo. Funktionalisierung von Kohlenstoffnanoröhren mit Proteinen und Quantenpunkten in wässrigen Pufferlösungen. Angewandte Physik Briefe. 2006. 88(063102).

Randell, S. H. und R. C. Boucher. Eine wirksame Schleimbeseitigung ist für die Gesundheit der Atemwege unerlässlich. Am J Respir Cell Mol Biol. 2006. 35(1): p. 20-8.

Skinner, K., C. Dwyer und S. Washburn. Selektive Funktionalisierung beliebiger Nanodrähte. Nano Lett. 2006. 6(12): p. 2758-62.

Sonnenwald, D. H., M. C. Whitton und K. Maglaughlin, Evaluation of a Scientific Collaboratory System: Investigation a Collaboratorys Potential before Deployment, in Wissenschaft im Internet, A.Z.N.B. G. Olson, Herausgeber. 2006, MIT-Presse: Boston.

Sul, O. J., M. R. Falvo, R. M. Taylor II, S. Washburn und R. Superfine. Thermisch betätigte, nicht angebundene stoßbetriebene Lokomotiv-Mikrogeräte. Appl. Phys. Lette.. 2006. 89(20): p. 203512.

Wen, Q., C. Healey, M.C. Whitton und R. M. Taylor II. Ein Vergleich der Benutzerleistung in einem immersiven HMD, einem Aquarium mit haptischen Displays zur Visualisierung volumetrischer Daten. Proceedings of Applied Perception in Graphics and Visualization 2006. 2006: s. 8 Seiten.

Borland, D., J. Clarke und R.M. Taylor II. Volumetrisches Tiefenpeeling für die virtuelle Arthroskopie. SPIE International Technical Group Newsletter. 2005. 16(2): p. 1.

Burns, E., S. Razzaque, A.T. Panter, M. C. Whitton, M. R. McCallus und F. P. Brooks Jr. The Hand is Slower than the Eye: Eine quantitative Untersuchung der visuellen Dominanz über die Propriozeption. in Proceedings of IEEE Virtual Reality 2005. Lobende Erwähnung im Best Paper Competition. 2005: IEEE-Computergesellschaft.

Burns, E., S. Razzaque, M.C. Whitton, M. R. McCallus, A. T. Panter und F. P. Brooks Jr. Die Hand lässt sich leichter täuschen als das Auge: Benutzer reagieren empfindlicher auf visuelle Interpenetration als auf visuell-propriozeptive Diskrepanzen. Präsenz: Teleoperatoren und virtuelle Umgebungen. 2005.

Cribb, J., D. B. Hill, R. M. Taylor, L. Vicci, J. Fisher, K. V. Desai, B. Wilde, J. Sheehan, M.G. Forest und R. Superfine. Messung lokaler mikrorheologischer Eigenschaften von menschlichem Schleim mit magnetisch angetriebenen Mikrokügelchen. Biophysikalisches Journal. 2005. 88(1): p. 505a-505a.

Fisher, J. K., J. R. Cummings, K. V. Desai, L. Vicci, B. Wilde, K. Keller, C. Weigle, G. Bishop, R.M. Taylor, C. W. Davis, R. C. Boucher, E. T. O’Brien und R. Superfine. Dreidimensionales Kraftmikroskop: Ein nanometrisches optisches Tracking- und magnetisches Manipulationssystem für die biomedizinischen Wissenschaften. Überprüfung wissenschaftlicher Instrumente. 2005. 76(5).

Hill, D. B., J. Cribb, H. Matsui und R. Superfine. Schwingungen im Schleimfluss. Biophysikalisches Journal. 2005. 88(1): p. 505a-505a.

Hollins, M., F. Lorenz, A. Seeger und R. Taylor. Faktoren, die zur Integration von Texturqualitäten beitragen: Beweise von virtuellen Oberflächen. Somatosens Mot Res. 2005. 22(3): p. 193-206.

Kohli, L., E. Burns, D. Miller und H. Fuchs. Kombinieren von passiver Haptik mit umgeleitetem Gehen. in die Internationale Konferenz für Künstliche Realität und Telexistenz (ICAT) 2005. 2005. Christchurch, Neuseeland.

Kohli, L. und M. C. Whitton. Die haptische Hand: Bereitstellung von Feedback zur Benutzeroberfläche mit der nicht dominanten Hand in virtuellen Umgebungen. in Proceedings of Graphics Interface 2005. 2005.

Marshburn, D., C. Weigle, B.G. Wilde, K. Desai, J.K. Fisher, J. Cribb, E. T. O’Brien, R. Superfine und R.M.T. II. Die Softwareschnittstelle zum 3D-Kraftmikroskop. Proceedings of IEEE Visualization. 2005: s. 455-462.

Meehan, M., S. Razzaque, B. Insko, M. Whitton und F.P. Brooks, Jr. Überprüfung von vier Studien zur Verwendung physiologischer Reaktionen als Maß für die Präsenz in stressigen virtuellen Umgebungen. Appl Psychophysiol Biofeedback. 2005. 30(3): p. 239-58.

Peng, L., R. Cubicciotti und M. Guthold. Neuartige Einzelmolekül-Methodik zur Identifizierung neuer Aptamere. Biophysikalisches Journal. 2005. 88(1): p. 65A Teil 2 Ergänzung S.

Stadermann, M., S.J. Papadakis, M. R. Falvo, Q. Fu, J. Liu, Y. Fridman, J.J. Borland, R. Superfine und S. Washburn. Exponentieller Abfall der lokalen Leitfähigkeit in einwandigen Kohlenstoffnanoröhren. Phys. Rev. B.. 2005. 72(24): p. 245406.

Whitton, M. C., J. Cohn, J. Feasel, P. Zimmons, S. Razzaque, J. Poulton, B. McLeod und F. P. Brooks Jr. Vergleich von VE Locomotion Interfaces. in Proceedings of IEEE Virtual Reality 2005. 2005. Bonn, Deutschland: IEEE Computer Society.

Whitton, M. C., J. Cohn, J. Feasel, P. Zimmons, S. Razzaque, S. Poulton, B. McLeod und F. P. Bäche. Vergleich von VE Locomotion Interfaces. in Proceedings of IEEE Virtual Reality 2005. 2005.

Cohn, M. C. Whitton, W. Becker und F. P. Brooks, Information Presentation and Control Method Impact Performance on a Complex Virtual Locomotion Task (Abstract), in Human Factors and Ergonomics Society. 2004: New Orleans, LO.

Dwyer, C., R.M. Taylor II, L. Vicci und J. Poulton. Parallele Computerarchitekturen, die durch Selbstmontage ermöglicht werden. Tagungsband der 1. Konferenz über die Grundlagen der Nanowissenschaften. 2004. 379.

Dwyer, C., L. Vicci, J. Poulton, D. Erie, R. Superfine, S. Washburn und R.M. Taylor II. Das Design von selbstgebauten DNA-Computing-Schaltungen. IEEE-Trans. auf VLSI. 2004. 12: P. 1214-20.

Dwyer, C., L. Vicci, J. Poulton und R.M. Taylor II. DNA Selbstorganisierte parallele Computerarchitekturen. Nanotechnologie. 2004. 15: P. 1688-94.

Guthold, M., Liu, W., Stephens, BJ, Lord, ST, Hantgan, RR, Erie, DA, Taylor, RM, Superfine, R. (2004) „Visualization and Mechanical Manipulations of Individual Fibrin Fibers Suggest that Fiber Cross -Abschnitt hat fraktale Dimension 1,3" Biophys. J. 87, 4226-36

Guthold, M., W. Liu, B. Stephens, S.T. Lord, R. R. Hantgan, D. A. Erie, R. M. Taylor, Jr. und R. Superfine. Visualisierung und mechanische Manipulationen einzelner Fibrinfasern legen nahe, dass der Faserquerschnitt eine fraktale Dimension von 1,3 hat. Biophys J. 2004. 87(6): p. 4226-36. 15465869

Hollins, M., A. Seeger, G. Pelli und R. Taylor. Haptische Wahrnehmung virtueller Oberflächen: Skalierung subjektiver Qualitäten und Interstimulusunterschiede. Wahrnehmung. 2004. 33(8): p. 1001-19. 15521697

Hudson, T., M. C. Whitton, A. Helser und D. H. Sonnenwald. Verwalten der Zusammenarbeit im nanoManipulator. Gegenwart. 2004. 13(2).

Jen, D., P. Parente, J. Robbins, C. Weigle, R.M. Taylor II, A. Burette und R. Weinberg. ImageSurfer: Ein Werkzeug zur Visualisierung von Korrelationen zwischen zwei Volumenskalarfeldern. in IEEE-Visualisierung 2004 – Proceedings. 2004. Austin, Texas.

Jones, G., T. Tretter, A. Bokinski und A. Negishi. Haptische Technologie und Lernen. Haptik-e. 2004.

Jones, M. G., T. Andre, D. Kubasko, A. Bokinski, T. Tretter, A. Negishi, R. M. Taylor II und R. Superfine praktische Untersuchungen mit mikroskopischen Organismen. Wissenschaftliche Bildung. 2004.

Jones, M. G., T. Andre, D. Kubasko, A. Bokinski, T. Tretter, A. Negishi, R. M. Taylor II und R. Superfine Remote Atomic Force Microscopy of Microscopic Organismen: Technologische Innovationen für praktische Wissenschaft mit Schülern der Mittel- und Oberstufe. Wissenschaftliche Bildung. 2004. 88: P. 55-71.

Jones, M. G., J. Minogue, T. Tretter, A. Negishi und R. M. Taylor II. Haptische Erweiterung des naturwissenschaftlichen Unterrichts: Ist Berührung wichtig? Wissenschaftliche Bildung. 2004.

Jones, M. G., T. Tretter, M. Paechter, D. Kubasko und A. Bokinski. Zuschauer oder Teilnehmer? Afroamerikanische Studenten, die über Wissenschaft schreiben. Wissenschaftliche Bildung. 2004.

Labbe, J. C., E. K. McCarthy und B. Goldstein. Die Kräfte, die eine mitotische Spindel asymmetrisch positionieren, werden bis nach dem Zeitpunkt der Spindelmontage angebunden. J Cell Biol. 2004. 167(2): p. 245-56. 15492042

Lok, B., S. Naik, M. C. Whitton und F. P. Brooks Jr. Auswirkungen des Umgangs mit realen Objekten und der Selbst-Avatar-Wiedergabe auf die kognitive Aufgabenleistung und das Präsenzgefühl in virtuellen Umgebungen. Journal on Presence: Teleoperatoren und virtuelle Umgebungen. 2004. 12(6): p. 615-628.

Matthews, W. G., A. Negishi, D. M. McCarty, R. J. Samulski, R. M. Taylor II und R. Superfine Kontrollierte Manipulation von makromolekularen Anordnungen und Mikrokügelchen über Oberflächen – Demonstration des Walzens auf der Nanometer-Längenskala. Langmuir. 2004.

Negishi, A., J. Chen, D.M. McCarty, R. J. Samulski, J. Liu und R. Superfine. Analyse der Wechselwirkung zwischen Adeno-assoziiertem Virus und Heparansulfat mittels Rasterkraftmikroskopie. Glykobiologie. 2004. 14(11): p. 969-77. 15215232

Paechter, M., M.G. Jones, T. Tretter, A. Bokinski, D. Kubasko, A. Negishi und T. Andre. Naturwissenschaftlicher Unterricht zum Anfassen: Den Unterricht gestalten, der für weibliche und männliche Schüler attraktiv ist. 2004.

Maler, J., M.G. Jones, D. Kubasko, T. Tretter, A. Negishi und T. Andre. Den Vorhang zurückziehen: Wissenschaftler im Klassenzimmer. Schulwissenschaften und Mathematik. 2004.

Papadakis, S. J., A. R. Halle, P. A. Williams, L. Vicci, M. R. Falvo, R. Superfine und S. Washburn. Resonanzschwinger mit Carbon-Nanotube-Torsionsfedern. Physische Überprüfungsschreiben. 2004. 93: P. 146101.

Stadermann, M., S.J. Papadakis, M. R. Falvo, J. Novak, E. Snow, Q. Fu, J. Liu, Y. Fridman, J.J. Boland, R. Superfine und S. Washburn. Nanoskalige Untersuchung der Leitung durch Kohlenstoff-Nanoröhrchen-Netzwerke. Physische Überprüfung B. 2004. 69(20): p. 201402.

Sul, O., S.J. Papadakis, M. R. Falvo, Y. Fridman, R. M. Taylor II, R. Superfine und S. Washburn. Bimorphe Aktoren auf Basis von Kohlenstoffnanoröhren: Thermische Biegung von Metall-Nanoröhren-Cantilevern. Appl. Phys. Lette.. 2004.

Taylor II, R. M., D. Borland, F. P. Brooks Jr., M. Falvo, M. Guthold, T. Hudson, K. Jeffay, G. Jones, D. Marshburn, S.J. Papadakis, L.-C. Qin, A. Seeger, F.D. Smith, D. H. Sonnenwald, R. Superfine, S. Washburn, C. Weigle, M. C. Whitton, P. Williams, L. Vicci und W. Robinett, Visualisierung und natürliche Kontrollsysteme für die Mikroskopie, in Visualisierungshandbuch, C.J.a.C. Hansen, Herausgeber. 2004, Harcourt Academic Press. P. 875-900.

Asokan, S. B., L. M. Jawerth, R. L. Carroll, R. E. Cheney, S. Washburn und R. Superfine Two-Dimensional Manipulation and Orientation of Actin-Myosin Systems with Dilectrophoresis. Nano-Buchstaben. 2003. 3(4): p. 431-437.

Bokinsky, A. Data Driven Spots: A Layered Visualization Technique for the Interactive Display of Multiple 2D Scalar Variables, in Computer Science 2003, University of North Carolina: Chapel Hill

Brooks Jr., F.P., Vorwort, in Detaillierungsgrad für 3D-Grafiken, D. Lübke et al., Herausgeber. 2003, Morgan Kaufmann Verlag: San Francisco, CA. P. ix.

Brooks Jr., F. P. Integration dynamischer realer Objekte in immersive virtuelle Umgebungen. in ACM SIGGRAPH. 2003. San Diego, CA: ACM-Transaktionen auf Grafiken.

Carter, G., M. G. Jones und M. Rua. Die Auswirkungen der Fähigkeiten des Partners auf die Leistung und die konzeptionelle Organisation von leistungsstarken Schülern der fünften Klasse. Wissenschaftliche Bildung. 2003. 87(1): p. 94-111.

Christiansen, N. und K.L. Maglachlin. Übergang vom physischen Arbeitsplatz zum virtuellen Arbeitsplatz: Seien Sie sich bewusst. in Internationale Konferenz zur Mensch-Computer-Interaktion. 2003.

Dwyer, C., R.M. Taylor II und L. Vicci. Leistungssimulation der nanoskaligen Siliziumstab-Feldeffekttransistorlogik. IEEE-Trans. auf Nanotechnologie. 2003. 2(2): p. 69-74.

Hall, A., G. Matthews, R. Superfine, M. Falvo und S. Washburn. Einfache und effiziente Methode zur Befestigung von Kohlenstoff-Nanoröhrchen an Abtastsonden und anderen Substraten. Appl. Phys. Lette.. 2003. 82(15): p. 2506-2508.

Hudson, T., A. Helser, D. H. Sonnenwald und M. C. Whitton. Verwalten der Zusammenarbeit im verteilten nanoManipulator. in IEEE Virtuelle Realität 2003. 2003. Los Angeles, CA: IEEE Press.

Hudson, T. Adapting Interactive Applications for Distributed Environments, in Computer Science 2003, UNC-CH: Chapel Hill

Jones, G., A. Bokinski, T. Tretter, A. Negishi, D. Kubasko, R. Superfine und R.M.Taylor II, Rasterkraftmikroskopie mit Berührung: Bildungsanwendungen, in Wissenschaft, Technologie und Ausbildung der Mikroskopie: ein Überblick, A. Mendez-Vilas, Herausgeber. 2003, Formatex: Madrid, Spanien.

Jones, G., T. Andre, R. Superfine und R.M. Taylor II. Lernen auf der Nanoskala: Der Einfluss der Studenten’-Anwendung der Remote-Mikroskopie auf Konzepte von Viren, Maßstab und Mikroskopie. Zeitschrift für Forschung im naturwissenschaftlichen Unterricht. 2003. 40(3): p. 303-322.

Jones, M. G., T. Hargrove und B. Jones. Die gescheiterten Metaphern des Lehrens. Der Schulverwalter. 2003. 60(11): p. 26-28.

Lok, B., Evaluierung und Anwendung von Algorithmen für ein hybrides Umgebungssystem, in Visualisierung und mechanische Manipulationen einzelner Fibrinfasern, B.Thompson, Herausgeber. 2003, University of Rochester Press: New York. P. 149-175.

Lok, B., S. Naik, M. C. Whitton und F. P. Brooks Jr. Auswirkungen des Umgangs mit realen Objekten und der Avatar-Wiedergabe auf die kognitive Aufgabenleistung in virtuellen Umgebungen. in IEEE Virtuelle Realität 2003. 2003. Los Angeles, Kalifornien.

Maglaughlin, K. L. Eine Untersuchung der Faktoren der interdisziplinären akademischen wissenschaftlichen Zusammenarbeit., in der School of Information and Library Science 2003, University of North Carolina at Chapel Hill:

Meehan, M., S. Razzaque, M. C. Whitton und F. P. Brooks Jr. Auswirkung der Latenz auf die Anwesenheit in stressigen virtuellen Umgebungen. in IEEE Virtuelle Realität 2003. 2003. Los Angeles, Kalifornien.

Papadakis, S. J., P. A. Williams, O. Sul, M. R. Falvo, R. Superfine und S. Washburn. Mechanik von Nanotubes und Nanotube-based Devices. in Internationale Winterschule für elektronische Eigenschaften neuartiger Materialien. 2003. Kirchberg, Österreich.

Prakash, R., S. Washburn, R. Superfine, R.E. Cheney und M. Falvo. Visualisierung einzelner Kohlenstoffnanoröhren mit Fluoreszenzmikroskopie unter Verwendung konventioneller Fluorophore. Appl. Phys. Lette.. 2003. 83: P. 1219-1221.

Seeger, A., C. Fretzagias und R. Taylor, 2. Software-Beschleunigungstechniken zur Simulation von Rasterelektronenmikroskop-Bildern. Scannen. 2003. 25(5): s. 264-73. 14748390

Sonnenwald, D.H. Erwartungen an eine wissenschaftliche Kooperation: Eine Fallstudie. in Konferenz der ACM GRUPPE 2003. 2003. NY: ACM-Presse.

Sonnenwald, D. H. und B. Li. Wissenschaftliche Kooperationen im Hochschulbereich: Erforschung von Lernstilpräferenzen und Wahrnehmungen von Technologie. British Journal of Educational Technology. 2003. 43(3): p. 419-431.

Sonnenwald, D. H., K. L. Maglaughlin und M. C. Whitton. Gestaltung zur Unterstützung des Situationsbewusstseins über Distanzen: Ein Beispiel aus einer wissenschaftlichen Kollaboration. Informationsverarbeitung und -management. 2003.

Sonnenwald, D. H., M. C. Whitton und K. L. Maglachlin. Evaluation einer wissenschaftlichen Kollaboration: Ergebnisse eines kontrollierten Experiments. ACM-Transaktionen bei Computer-Mensch-Interaktion. 2003. 10(2): p. 150-176.

Sonnenwald, D. H., M. C. Whitton und K. L. Maglachlin. Wissenschaftliche Kooperationen: Bewertung ihres Potenzials. ACM-Interaktionen. 2003. 19(4): p. 9-10.

Stadermann, M. Buckling Nanotube with Conductivity Map (Visualization Challenge). Wissenschaft. 2003. 301: P. 1473.

Stadermann, M., H. Grube, J. Boland, S.J. Papadakis, M. R. Falvo, R. Superfine und S. Washburn. Simultane Rasterkraftmikroskopie-Messung der Topographie und des Kontaktwiderstands von Metallschichten und Kohlenstoff-Nanoröhrchen. Überprüfung wissenschaftlicher Instrumente. 2003. 74(8): p. 3653-3655.

Stilwell, J. L., D. M. McCarty, A. Negishi, R. Superfine und R.J. Samulski. Entwicklung und Charakterisierung neuer leerer Adenovirus-Capside und deren Einfluss auf die zelluläre Genexpression. J Virol. 2003. 77(23): p. 12881-5. 14610209

Sul, O., S.J. Papadakis, M. Falvo, Y. Fridman, R. M. Taylor II, S. Washburn und R. Superfine Bimorph-Aktuatoren basierend auf Kohlenstoff-Nanoröhrchen: Thermische Biegung von Metall-Nanoröhren-Cantilevern. Appl. Phys. Lette.. 2003.

Taylor II, R. M., C. Ware und V. Interrante. Wahrnehmungsbasiertes Visualisierungsdesign. in Kursnotizen für SIGGRAPH 2003 Kurs #45, Ganztageskurs Visualisierung organisiert von R.M. Taylor II. 2003. San Diego, Kalifornien.

Tretter, T. und G. Jones. A Sense of Scale: Untersuchen, wie sich Skala auf Systeme und Organismen auswirkt. Naturwissenschafts-Lehrer. 2003. 70(1): p. 22-25.

Tretter, T. und M.G. Jones. Beziehungen zwischen forschendem Unterricht und physikalisch-wissenschaftlichen standardisierten Testergebnissen. Schulwissenschaften und Mathematik. 2003. 103(7): p. 345-350.

Wang, H., Y. Yang, M. J. Schofield, C. Du, Y. Fridman, S. D. Lee, E. D. Larson, J. T. Drummond, E. Alani, P. Hsieh und D.A. Erie. DNA-Biegung und -Entbiegung durch MutS regeln die Erkennung und Spezifität von Fehlpaarungen. Proc Natl Acad Sci U S A. 2003. 100(25): p. 14822-7. 14634210

Whitton, M. C. Machen virtuelle Umgebungen überzeugend. Mitteilungen des ACM. 2003.

Williams, P., S. J. Papadakis, A. Patel, M. Falvo, S. Washburn und R. Superfine Fabrication of Nanometer-scale Mechanical Devices Incorporating individuelle mehrwandige Kohlenstoff-Nanoröhrchen als Torsionsfedern. Appl. Phys. Lette.. 2003. 82: P. 805.

Zhang, J., G. L. Wang, Y. S. Shon, O. Zhou, R. Superfine und R. Murray. Wechselwirkungen kleiner Moleküle und Au-Nanopartikel mit solubilisierten einwandigen Kohlenstoff-Nanoröhren. Zeitschrift für Physikalische Chemie B. 2003. 107(16): p. 3726-3732.

Zimmons, P. The Influence of Lighting Quality on Presence and Task Performance in Virtual Environments, in Computer Science 2003, UNC-CH: Chapel Hill S.244

Brooks Jr., F.P., Die Geschichte des IBM Betriebssystems / 360, in Software-Pioniere: Beiträge zum Software-Engineering, M. Broy und E. Denert, Herausgeber. 2002, Springer: Berlin. P. 170-178.

Dwyer, C., R. Taylor und L. Vicci. Transportsimulation eines nanoskaligen Siliziumstab-Feldeffekttransistors. in 2. IEEE-Konferenz für Nanotechnologie. 2002. Arlington, VA.

Dwyer, C., M. Guthold, M. Falvo, S. Washburn, R. Superfine und D. Erie. DNA-funktionalisierte einwandige Kohlenstoffnanoröhren. Nanotechnologie. 2002. 13: P. 601-4.

Dwyer, C., R. Taylor und L. Vicci. Mixed-Mode-Simulation einer nanoskaligen Siliziumstab-Feldeffekttransistorlogik. IEEE-Trans. auf Nanotechnologie. 2002.

Harris, M. J., G. Coombe, T. Scheuermann und A. Lastra. Physikalisch basierte visuelle Simulation auf Grafikhardware. in 2002 SIGGRAPH / Eurographics Workshop zu Grafikhardware. 2002. Saarbrücken, Deutschland.

Jones, M. G., T. Andre, D. Kubasko, A. Bokinsky, T. Tretter, A. Negishi, R. Taylor und R. Superfine. Praktische Untersuchungen mit mikroskopischen Organismen. Wissenschaftliche Bildung. 2002.

Lok, B.C.L. Interagieren mit dynamischen realen Objekten in virtuellen Umgebungen, in Computer Science 2002, University of North Carolina: Chapel Hill S.172

Maglaughlin, K. L. und D. H. Sonnenwald. Nutzerperspektiven zu Relevanzkriterien: Ein Vergleich zwischen relevanten, teilweise relevanten und nicht relevanten Urteilen. Zeitschrift der American Society of Information and Technology. 2002. 53(5): s. 327-342.

Meehan, M., B. Insko, M. Whitton und F.P. Brooks Jr. Physiologische Präsenzmessungen in stressigen virtuellen Umgebungen. ACM-Transaktionen auf Grafiken. 2002. 21(3): p. 645-652.

Mortensen, J., V. Vinayagamoorthy, M. Slater, A. Steed, B. Lok und M.C. Whitton. Zusammenarbeit in teleimmersiven Umgebungen. in Achter Eurographics-Workshop zu virtuellen Umgebungen. 2002. Barcelona, ​​Spanien: ACM – The Eurographics Association.

Razzaque, S., D. Swapp, M. Slater, M. C. Whitton und A. Ross. Umgeleitetes Gehen an Ort und Stelle. in Achter Eurographics-Workshop zu virtuellen Umgebungen. 2002. Barcelona, ​​Spanien: ACM – The Eurographics Association.

Sonnenwald, D. H., M. C. Whitton und K. L. Maglachlin. Wissenschaftliche Kooperationen. ASIS&T-Bulletin. 2002. 28(6).

Superfein, R., M. Falvo, R.M. Taylor II und S. Washburn, Nanomanipulation: Buckling, Transport and Rolling at the Nanoscale, in CRC Handbook of Nanoscience, Engineering, and Technology, S. Lyshevski et al., Herausgeber. 2002, CRC Press LLC: Boca Raton.

Superfine, R., G. Bishop, J. Cummings, J. Fisher, K. Keller, G. Matthews, D. Sill, R.M. Taylor II, L. Vicci, C. Weigle, G. Welch und B. Wilde. Berühren in biologischen Systemen: Ein 3D-Kraftmikroskop. in Mikroskopie und Mikroanalyse 2002. 2002. Quebec City, Kanada.

Taylor II, R. M. Visualisieren mehrerer Felder auf derselben Oberfläche. IEEE Computergrafik und Anwendungen. 2002 (März-Apr): p. 6-10.

Varadhan, G., W. Robinett, D. Erie und R.M. Taylor II. Schnelle Simulation der rasterkraftmikroskopischen Abbildung atomarer und polygonaler Oberflächen mit Grafikhardware. in SPIE-Konferenz zu Visualisierung und Datenanalyse. 2002. Kongresszentrum von San Jose, San Jose, CA.

Washburn, S. und S. J. Papadakis. Transport über atomar ausgerichtete Grenzflächen: Fingerspitzenmanipulation und elektrische Sondierung von Nanoröhren. in Internationaler Workshop zu Elektroneninterferenz und Dekohärenz in Nanostrukturen. 2002. Max-Planck-Institut für Physik komplexer Systeme.

Williams, P. A., S. J. Papadakis, M. R. Falvo, A. M. Patel, M. Sinclair, A. Seeger, A. Helser, R.M. Taylor II, S. Washburn und R. Superfine. Kontrollierte Platzierung einer einzelnen Kohlenstoffnanoröhre auf einer mikroelektromechanischen Struktur. Angewandte Physik Briefe. 2002. 80(14): p. 2574-2576.

Williams, P. A., S. J. Papadakis, A. M. Patel, M. R. Falvo, S. Washburn und R. Superfine. Torsionsreaktion und Versteifung einzelner mehrwandiger Kohlenstoffnanoröhren. Phys Rev Lett. 2002. 89(25): p. 255502. 12484895

Brooks Jr., F. P. Die Geschichte des IBM-Betriebssystems/360. in SD&M Software Pioneers Conference. 2001. Bonn, Deutschland.

Guthold, M. und D. A. Erie. Einzelmolekülstudie zeigt eine komplexe E. coli-RNA-Polymerase. Chembiochem. 2001. 2(3): p. 167-70. 11828441

Guthold, M., R. Superfine und R.M. Taylor II. Die Regeln ändern sich: Kraftmessungen an einzelnen Molekülen und wie sie sich auf die Kinetik und Energien von Massenreaktionen beziehen. Biomedizinische Mikrogeräte. 2001. 3(1): p. 9-18.

Harris, M. und A. Lastra. Cloud-Rendering in Echtzeit. Computergrafik-Forum. 2001. 20(3): p. 76-84.

Hudson, T. C., M. C. Weigle, K. Jeffay und R.M. Taylor II. Experimente in Best-Effort Multimedia Networking für eine verteilte virtuelle Umgebung. Proceedings of Multimedia Computing and Networking. 2001 (Januar): p. 88-98.

Insko, B. Passive Haptics verbessert virtuelle Umgebungen erheblich, in Computer Science 2001, University of North Carolina: Chapel Hill

Jeffay, K., T. Hudson und M. Parris. Mehr als Audio und Video: Multimedia-Netzwerkunterstützung für verteilte, immersive virtuelle Umgebungen. in 27. EUROMICRO-Konferenz. 2001. Warschau, Polen.

Lindholm, E., M. J. Kligard und H. Moreton. Eine vom Benutzer programmierbare Vertex-Engine. in Internationale Konferenz für Computergrafik und interaktive Techniken. 2001: ACM-Presse.

Lok, B. Online-Modellrekonstruktion für interaktive virtuelle Umgebungen. in ACM Symposium über interaktive 3D-Grafiken. 2001.

Meehan, M., B. Insko, M. C. Whitton und F. P. Bäche. Physiologische Präsenzmessungen in virtuellen Umgebungen. in 4. Internationaler Präsenzworkshop. 2001. Philadelphia.

Meehan, M. Physiologische Reaktion als objektives Maß der Präsenz in virtuellen Umgebungen, in Computer Science 2001, University of North Carolina: Chapel Hill S.142

Razzaque, S., Z. Kohn und M.C. Whitton. Umgeleitetes Gehen. in Eurographics 2001. 2001.

Seeger, A., S. Paulson, M. Falvo, A. Helser, R.M. Taylor, R. Superfine und S. Washburn. Wie fühlt es sich an, ein Molekül zu rollen? in 45. Internationale Konferenz für Elektronen-, Ionen- und Photonenstrahltechnologie und Nanofabrikation. 2001.

Seeger, A., S. Paulson, M. Falvo, A. Helser, R.M. Taylor II, R. Superfine und S. Washburn. Hands-on-Tools für die Nanotechnologie. Zeitschrift für Vakuumwissenschaft und -technologie. 2001. B 19: P. 2717-2722.

Sonnenwald, D. H., R. E. Bergquist, K. L. Maglaughlin, E. Kupstas-Soo und M.C. Whitton, Designing to support colaborative wissenschaftliche Forschung über Distanzen: Die nanoManipulator-Umgebung, in Kollaborative virtuelle Umgebungen, E. Churchill, D. Snowdon und A. Munro, Herausgeber. 2001, Springer-Verlag: London. P. 202-224.

Sonnenwald, D. H., K. L. Maglaughlin und M. C. Whitton. Verwendung der Innovationsdiffusionstheorie als Leitfaden für die Bewertung der Zusammenarbeitstechnologie: In Arbeit. in IEEE 10th International Workshop on Enabling Technologies for Collaborative Enterprises (WETICE). 2001. NY: IEEE-Presse.

Taylor II, R. M., T. C. Hudson, A. Seeger, H. Weber, J. Juliano und A.T. Helser. VRPN: Ein geräteunabhängiges, netzwerktransparentes VR-Peripheriesystem. in ACM Symposium über Virtual-Reality-Software und -Technologie 2001. 2001. Banff Centre, Kanada.

Arthur, K. Auswirkungen des Sichtfelds auf die Leistung mit kopfmontierten Displays, in Computer Science 2000, University of North Carolina: Chapel Hill

Brooks Jr., F. P. Das Design des Designs. in Turing Award-Adresse bei SIGGRAPH 󈧄. 2000: Mitteilungen des ACM.

Christiansen, M., K. Jeffay, D. Ott und F.D. Schmied. RED für Web-Traffic einstellen. in ACM SIGCOMM. 2000. Stockholm, Schweden.

Falvo, M. R., J. Steele, R. M. T. II und R. Superfein. Zahnradartige Rollbewegung, vermittelt durch entsprechenden Kontakt: Carbon Nanotubes auf HOPG. Phys. Rev. B. 2000. 62(15. Oktober): p. 10665-10667.

Falvo, M. R., J. Steele, R. M. T. II und R. Superfein. Nachweis von entsprechenden Kontakt- und Rollbewegungen: AFM-Manipulationsstudien von Kohlenstoffnanoröhren auf HOPG. Tribologie-Briefe. 2000. 9: P. 73-76.

Falvo, M. R. und R. Superfine. Mechanik und Reibung im Nanometerbereich. Zeitschrift für Nanopartikelforschung. 2000. 2: P. 237-248.

Gregory, A., M. C. Lin, S. Gottschalk und R.M.T. II. Echtzeit-Kollisionserkennung für haptische Interaktion mit einem 3-DoF-Force-Feedback-Gerät. Computational Geometry: Theorie und Anwendungen (Sonderheft zu virtuellen Umgebungen). 2000. 15(1-3): s. 69-89.

Guthold, M., M. R. Falvo, W. G. Matthews, S. Paulson, S. Washburn, D. Erie, R. Superfine, F. P. Brooks und R. M. Taylor. Kontrollierte Manipulation von molekularen Proben mit dem nanoManipulator. IEEE/ASME-Transaktionen zu Mechatronik. 2000. 5(2): p. 189-198.

Guthold, M., J. Mullin, S. Lord, D. Erie, R. Superfine und R. Taylor. Kontrollierte Manipulation einzelner Fibrinmoleküle. Biophys. J.. 2000. 78: P. A53.

Paulson, S., A. Helser, M.B. Nardelli, R.M.T. II, M. Falvo, R. Superfine und S. Washburn. Einstellbarer Widerstand einer Kohlenstoff-Nanoröhrchen-Graphit-Grenzfläche. Wissenschaft. 2000. 290(Dezember): p. 1742-1744.

Rivetti, C., M. Guthold und C. Bustamante, DNA-Umhüllung in offene Promotorkomplexe der E. coli-RNA-Polymerase, die durch Rasterkraftmikroskopie nachgewiesen wurden, in Protein-DNA-Wechselwirkungen: Ein praktischer Ansatz, A. Travers und M. Buckle, Herausgeber. 2000, Oxford University Press: Oxford.

Seeger, A., A. Henderson, G. L. Pelli, M. Hollins und R. M. T. II. Haptische Darstellung mehrerer Skalarfelder auf einer Fläche. in Workshop zu neuen Paradigmen in der Informationsvisualisierung und -manipulation. 2000. Washington, D. C.: ACM Press.

Mit freundlichen Grüßen M. NanoManipulator lässt Chemiker gehen Mano a Mano mit Molekülen. Wissenschaft. 2000. 290(24. November): p. 1530.

Superfine, R., G. Jones und R.M. Taylor II. Berühren von Viren in einem vernetzten Mikroskopie-Outreach-Projekt. in Konferenz zum K-12-Outreach von wissenschaftlichen Fakultäten der Universität. 2000. North Carolina State University: Wissenschaftshaus.

Taylor II, R. M. Praktische wissenschaftliche Visualisierungsbeispiele. Computergrafik. 2000. 34(1): p. 74-79 und Deckel.

Weigle, C., W. G. Emigh, G. Liu, R. M. Taylor, J. T. Enns und C. G. Healey. Oriented Texture Splitter: Eine Technik zur lokalen Wertschätzung mehrerer skalarer Felder. in Grafikschnittstelle. 2000. Montreal, Kanada.

Bastos, R., K. Hoff, W. Wynn und A. Lastra. Erhöhter Fotorealismus für interaktive architektonische Walkthroughs. in Proceedings of the 1999 Symposium on Interactive 3D Graphics. 1999.

Brooks Jr., F. P. Was ist an Virtual Reality real? IEEE Computergrafik und Anwendungen. 1999. 19 (6)(Nov./Dez.): p. 16-27.

Bustamante, C., M. Guthold, X. Zhu und G. Yang. Erleichterte Ziellokalisierung auf DNA durch einzelne Escherichia coli-RNA-Polymerase-Moleküle, die mit dem Rasterkraftmikroskop in Flüssigkeit beobachtet wurden. J Biol Chem. 1999. 274(24): p. 16665-8. 10358002

Clark, M. und K. Jeffay. Leistungsmessungen auf Anwendungsebene des vBNS. in IEEE International Conference on Multimedia Computing and Systems. 1999. Florenz, Italien.

Falvo, M. R., G. Clary, A. Helser, S. Paulson, R. M. Taylor II, V. Chi, F. P. Brooks Jr., S. Washburn und R. Superfine. Nanomanipulationsexperimente zur Untersuchung der Reibungs- und mechanischen Eigenschaften von Kohlenstoffnanoröhren. Mikroskopie und Mikroanalyse. 1999. 4: P. 504-512.

Falvo, M. R., R. M. Taylor, 2., A. Helser, V. Chi, F.P. Brooks, Jr., S. Washburn und R. Superfine. Nanometerskaliges Rollen und Gleiten von Kohlenstoff-Nanoröhrchen. Natur. 1999. 397(6716): p. 236-8. 9930698

Gregory, A., M. C. Lin, S. Gottschalk und R. Taylor. H-COLLIDE: Ein Framework für schnelle und genaue Kollisionserkennung für haptische Interaktion. in Verfahren von VR 󈨧. 1999. Houston, Texas.

Guthold, M., M. Falvo, W. G. Matthews, S. Paulson, J. Mullin, S. Lord, D. Erie, S. Washburn, R. Superfine, F.P. Brooks, Jr. und R.M. Taylor, 2. Untersuchung und Modifikation molekularer Strukturen mit dem nanoManipulator. J-Mol-Graph-Modell. 1999. 17(3-4): p. 187-97. 10736776

Guthold, M., M. R. Falvo, W. G. Matthews, S. Paulson, S. Washburn, D. Erie, R. Superfine, J. F. P. Brooks und R. M. T. II. Kontrollierte Manipulation von molekularen Proben mit dem nanoManipulator. 1999.

Guthold, M., G. Matthews, A. Negishi, R.M. Taylor II, D. Erie, F.P. Brooks Jr. und R. Superfine. Quantitative Manipulation von DNA und Viren mit dem nanoManipulator Rasterkraftmikroskop. Surfen. Interf. Analyse. 1999. 27: P. 437-443.

Guthold, M., X. Zhu, C. Rivetti, G. Yang, N. H. Thomson, S. Kasas, H. G. Hansma, B. Smith, P.K. Hansma und C. Bustamante. Direkte Beobachtung der eindimensionalen Diffusion und Transkription durch Escherichia coli RNA Polymerase. Biophys J. 1999. 77(4): p. 2284-94. 10512846

Jeffay, K. Hin zu einem Weiterleitungsdienst für Multimediaflüsse, der besser als der beste Aufwand ist. IEEE-Multimedia. 1999. 6(4 (Oktober-Dezember)): p. 84-88.

Jones, G. M., R. Superfine und R. M. T. II. Virtuelle Viren. Naturwissenschafts-Lehrer. 1999. 66(7): p. 48-50.

Matthews, W. G., A. Negishi, A. Seeger, R. Taylor, D.M. McCarty, R. J. Samulski und R. Superfine. Elastizität und Bindung von Adenovirus in Luft und in Flüssigkeit. 43. Jahresversammlung der Biophysical Society, 13.-17. Februar 1999, Baltimore, MD Biophys.J.. 1999. A27.

Negishi, A., W. G. Matthews, D. M. McCarty, R. J. Samulski, D. Rohrer, A. Henderson, R. Taylor und R. Superfine. Untersuchung der strukturellen Eigenschaften von Adenovirus mit dem Rasterkraftmikroskop. 43. Jahresversammlung der Biophysical Society, 13.-17. Februar 1999, Baltimore, MD Biophys. J.. 1999. 76: P. A27.

Paulson, S., M. R. Falvo, N. Snider, A. Helser, T. Hudson, A. Seeger, R.M. Taylor, R. Superfine und S. Washburn. In-situ-Widerstandsmessungen von gespannten Kohlenstoff-Nanoröhrchen. Angewandte Physik Briefe. 1999. 75(19): p. 2936-2938.

Rivetti, C., M. Guthold und C. Bustamante. Wickeln von DNA um den offenen Promotorkomplex der E.coli-RNA-Polymerase. Embo J. 1999. 18(16): p. 4464-75. 10449412

Sonnenwald, D. H., E. Kupstas Soo und R. Superfine Eine mehrdimensionale Bewertung des nanoManipulators, eines wissenschaftlichen Kooperationssystems. ACM SIGGROUP-Bulletin. 1999. 20(2): p. 46-50.

Taylor II, R. M. und R. Superfine, Advanced Interfaces to Scanned-Probe Mikroskope, in Handbuch Nanostrukturierte Materialien und Nanotechnologie, H. S. Nalwa, Herausgeber. 1999, Akademische Presse: New York. P. 271-308.

Taylor II, R. M. Wissenschaftliche Anwendungen von Force Feedback: Molekulare Simulation und Mikroskopsteuerung. in SIGGRAPH 󈨧. 1999. Los Angeles, Kalifornien.

Usoh, M., K. Arthur, M. C. Whitton, R. Bastos, A. Steed, M. Slater und F.P. Bäche. Gehen > Gehen auf der Stelle > Fliegen in virtuellen Umgebungen. in Proz. von SIGGRAPH 󈨧, Computer Graphics Proceedings, Annual Conference Series. 1999.

Arthur, K., T. Preston, R. Taylor, F.P.B. Jr., M. C. Whitton und W. V. Wright. Das PIT: Design, Implementierung und nächste Schritte. in 2. Internationaler Workshop für immersive Projektionstechnologie. 1998. Ames, Iowa.

Grant, B., A. Helser und R.M. Taylor II. Hinzufügen einer Force-Anzeige zu einer stereoskopischen Head-Tracking-Projektionsanzeige. in VRAIS 󈨦. 1998. Atlanta, GA.

Ratcliff, G. C., D. A. Erie und R. Superfein. Photothermische Oszillation für die Rasterkraftmikroskopie im oszillierenden Modus in Lösung. Appl. Phys. Lette.. 1998. 72(15): p. 1911-1913.

Robinett, W. Umschalten zwischen den vier Modi eines Teleoperatorsystems: Teleoperation, Simulation, Replay und Robot. in Internationale Konferenz über Künstliche Realität und Tele-Existenz. 1998. Tokio, Japan.


Materialen und Methoden

Mutante Allele

Histochemischer Nachweis der β-Galactosidase-Aktivität und Antikörperfärbung

Die histochemische Färbung wurde an handsezierten Eingeweiden nach Murakami et al. (1994). Die Antikörperfärbung der Embryonen erfolgte nach Standardmethoden mit Anti-Ultrabithorax- und Anti-Labial-Antikörpern (Panganiban et al. 1990) oder dem monoklonalen Anti-Myc-Tag 9E10 (Oncogene Research Products) bei 1:500, gefolgt von einer Verstärkung mit dem Vectastain® Elite-ABC-Kit. Gefärbte Embryonen und sezierte Eingeweide wurden entweder mit einem Zeiss Axiophot Mikroskop fotografiert und die Bilder mit einem Nikon Coolscan gescannt oder mit einer Spot Digitalkamera auf einem Leica DMR Mikroskop fotografiert. Die digitalen Bilder wurden mit Adobe Photoshop 4.0 zusammengestellt und mit FreeHand 8.0 auf einem Power Macintosh beschriftet.

Konstruktion von Genen, die für Torso/β . kodierenzytFusionsproteine

Die UAS–Torso WT /βzytGen wurde konstruiert, indem in einer Reihe von Schritten die folgenden fünf DNA-Fragmente kombiniert wurden: (1) a KpnICH-CelII (ausgefüllt) Fragment von pUAST (Brand und Perrimon 1993), das den UAS-Promotor und 36 Nukleotide von HSP70 5' untranslatierte Sequenz (2) und 36 Nukleotide enthält Xhoich (ausgefüllt) zu SspBI-Fragment aus pBD490 (B. Dickson und E. Hafen, pers. Mitt.), das eine Signalsequenz gefolgt von einem myc-Tag und dem Aminoterminus der extrazellulären Domäne des Torsos enthält (3) an SspBI-ÖkoRI (ausgefüllt) Fragment vonTorsoWT–sev (Dickson et al. 1992) enthaltend den Rest der extrazellulären Domäne des Torsos und der Transmembrandomäne (4) aBamHI (mit Mungbohnen-Nuklease getrimmt) zu SpeI-Fragment von pβcyt (siehe unten), das die zytoplasmatische Domäne des Integrins β . enthältPS Untereinheit (5) aSpeICH-RsrII-Fragment mit der Polyadenylierungsstelle des rosig Gen (Martin-Bermudo et al. 1997). Das Gen wurde zwischen KpnIch und RsrII-Stellen in einem P-Element-Vektor, der die Weiß Gen als selektierbarer Marker (pWhiteRabbit, N.H. Brown unveröffentlicht). Das Plasmid pβcyt, das a . enthält BamHI-Stelle an der Verbindung zwischen der Transmembran- und der zytoplasmatischen Domäne des βPS Untereinheit, wurde durch PCR erzeugt, mit dem Primer GGAGGATCCTCACTACGATCCAC und einem Primer im Vektor, kloniert als a BamHI-NichtIch fragmentiere und überprüfe durch Sequenzierung (die SpeDie für Fragment 4 verwendete I-Stelle liegt innerhalb der 3′-untranslatierten Region desβPS Gen). Die Aminosäuresequenzen an den Verbindungen zwischen Transmembran- und zytoplasmatischen Domänen sind -LLLWKLLTTIHDRR- im βPS Untereinheit und -LTFC RILTTIHDRR- im Torso WT /βzyt Fusion (die Torsosequenz ist unterstrichen und die Verbindungsaminosäuren RI stammen aus der synthetischen ÖkoRI-Site). Um die . zu generierenUAS–Torso D /βzytGen, a NgoMI–ÖkoRI-Fragment ausUAS–Torso WT /βzytwurde durch das entsprechende Fragment aus . ersetztTorso4021–Sev (Dickson et al. 1992). P-Element-Transformanten wurden durch Standardverfahren erhalten, und für jedes Konstrukt wurden mehrere Linien erhalten. Unabhängige Linien der Konstrukte wurden die Linien B, E2 und D1 für die UAS–Torso WT /βzytGen und Linien B und C für dieUAS–Torso D /βcytGen. Sie wurden im Mitteldarm durch die GAL4-Linie exprimiert 48Y, das ab Stadium 12 im Mitteldarm exprimiert wird (Martin-Bermudo et al. 1997). Um die eindeutig zu unterscheiden miauen mutierten Embryonen haben wir ein mit markiertes Balancer-Chromosom verwendet Gelb + (Martin-Bermudo et al. 1997), zum Beispiel jungfräuliche Weibchen y mew M6 /FM6, y + UAS–Torso D /βzyt wurden gekreuzt zuja + /Ja 24B 258 Männchen. Im Nachwuchs werden sich alle ausdrücken UAS–Torso D /βzytunter der Kontrolle von 48Y und enthalten die 258 Enhancer-Falle, und die 1/4, die für mutiert sind miauen kann durch ihre unterschieden werdenja Mundhaken.

Um die Rolle der α-Untereinheiten zu beurteilen, verwendeten wir die folgenden UAS-Konstrukte: UAS–PS1 2.1, UAS–PS1/2cyt 2.1, UAS–PS2/1cyt 2.A, UAS–PS2 2A (Martin-Bermudo et al. 1997) .


Tumorbiologie (10/13)

-Schützen Sie die offenen Enden der Chromosomen vor Rekombination, End-to-End-Fusion und Erkennung als beschädigte DNA
-Ermöglicht die vollständige DNA-Replikation
-Assoziieren miteinander, um die Transkription zu regulieren, die Paarung von Schwesterchromosomen bei der Mitose zu erleichtern und Chromosomen an Kernmembranen zu verankern

Selbsterneuerung (kann zwei Tochterzellen bilden, wobei eine oder beide die gleichen biologischen Eigenschaften wie die Mutterzelle beibehalten)

Langzeiterhaltung des Tumors

Dies führt zu einer erhöhten Glukoseaufnahme (weil sie weniger effizient ist) aufgrund der Verschiebung der Isozyme

Früher Tumor dehnt sich aus --> überschreitet die Diffusionsgrenzen der lokalen Blutversorgung --> Hypoxie --> Stabilisierung von HIF

Adipozyten - erhöhte Tumorzellmigration, Invasion durch Regulierung der Expression und Aktivierung von MMPs, proinflammatorische Adipokine

ECs - Leukozytenrekrutierung und Tumorzellverhalten und Metastasierung, bilden angiogene Gefäße, MMP- und TIMP-Expression zur Beeinflussung der Tumorprogression

Perizyten - stabilisieren Blutgefäße, hemmen die EC-Proliferation, halten den Kapillardurchmesser aufrecht, regulieren den Blutfluss, liefern EC-Überlebenssignale über heterotypische Kontakte und lösliche Faktoren

DCs - induzieren Vaskularität, Tumorimmunpathogenese, Pro- und Antitumorfunktionen

Makrophagen - Immunregulation, Zellwachstum und Tumorentwicklung

Immunzellen - Wachstum und Progression durch TAMs und myeloische, unterdrückende Zellen und ihre Zytokine (IL-23, IL-6, IL-1B und TNF-a)


Integrinaktivierung und strukturelle Umlagerung

Anschriften der Autoren Junichi Takagi, Timothy A. Springer, Center for Blood Research, Departments of Pathology and Pediatrics, Harvard Medical School, Boston, Massachusetts, USA.

Adressen der Autoren Junichi Takagi, Timothy A. Springer, Center for Blood Research, Departments of Pathology and Pediatrics, Harvard Medical School, Boston, Massachusetts, USA.

Anschriften der Autoren Junichi Takagi, Timothy A. Springer, Center for Blood Research, Departments of Pathology and Pediatrics, Harvard Medical School, Boston, Massachusetts, USA.

Anschriften der Autoren Junichi Takagi, Timothy A. Springer, Center for Blood Research, Departments of Pathology and Pediatrics, Harvard Medical School, Boston, Massachusetts, USA.

Junichi TakagiTimothy A. Springer

Abstrakt

Zusammenfassung: Unter den Adhäsionsrezeptorfamilien sind Integrine besonders wichtig in biologischen Prozessen, die eine schnelle Modulation der Adhäsion und Deadhäsion erfordern. Die Aktivierung von β2-Integrinen auf Leukozyten und β3-Integrinen auf Blutplättchen auf einer Zeitskala von < 1 s ermöglicht die Ablagerung dieser Zellen an Entzündungsstellen oder Gefäßwandverletzungen. Neuere Kristall-, Kernspinresonanz(NMR)- und Elektronenmikroskop(EM)-Strukturen von Integrinen und ihren Domänen führen zu einem vereinheitlichenden Aktivierungsmechanismus sowohl für Integrine, die eine inserierte (I)-Domäne enthalten, als auch für solche, denen eine inserierte (I)-Domäne fehlt. Die I-Domäne nimmt zwei alternative Konformationen an, die als offen und geschlossen bezeichnet werden. In auffallender Ähnlichkeit mit signalgebenden G-Proteinen ist die Neuordnung einer Mg 2+ -Bindungsstelle mit großen Konformationsbewegungen in entfernten Rückgratregionen verbunden. Mutationen, die eine bestimmte Konformation stabilisieren, zeigen, dass die offene Konformation eine hohe Affinität zum Liganden aufweist, während die geschlossene Konformation eine niedrige Affinität aufweist. Die Bewegung der C-terminalen α-Helix 10 entlang der Seite der Domäne in der offenen Konformation ist ausreichend, um die Affinität an der distalen Ligandenbindungsstelle um das 9000-fache zu erhöhen. Dieses C-terminale „Glockenseil“ bietet einen Mechanismus für die Verknüpfung mit Konformationsbewegungen in anderen Domänen. Neuere Strukturen und funktionelle Studien zeigen Wechselwirkungen zwischen β-Propeller, I und I-ähnlichen Domänen im Integrin-Kopfstück und eine kritische Rolle für die Integrin-Epidermal-Wachstumsfaktor-(EGF)-Domänen in der Stielregion. Das Kopfstück des Integrins zeigt in der inaktiven Konformation nach unten zur Membran und ragt bei Aktivierung nach oben in einer „Schalterklinge“-ähnlichen Öffnung. Diese weitreichenden strukturellen Neuordnungen des gesamten Integrinmoleküls mit Interdomänenkontakten scheinen eng mit Konformationsänderungen innerhalb der I- und I-ähnlichen Domänen verbunden zu sein, was zu einer erhöhten Affinität und Kompetenz für die Ligandenbindung führt.


Ergebnisse

MTT-Assay

EGF-Konzentrationen und Behandlungszeiten basierten auf früheren Studien mit Dickdarmkrebs-Zelllinien. Insbesondere wurden HCT116-Zellen mit 1, 10 oder 100 ng/ml EGF für 5, 30 min, 1, 12, 24 oder 48 h behandelt und die Proliferation wurde durch den MTT-Assay bestimmt. Diese Analysen zeigten, dass die Zellproliferation von HCT116 konzentrations- und zeitabhängig allmählich zunahm (Abb. 1).

Veränderungen von EGF-behandelten HCT116-Zellen. Die optimale EGF-Konzentration für zukünftige Experimente wurde auf 100 ng/ml eingestellt, und die optimale EGF-Expositionszeit wurde hauptsächlich auf 24 und 48 h eingestellt (CTL Steuerung)

Veränderungen der Integrin-β1- und Rab25-Expression nach EGF-Exposition

HCT116-Zellen wurden 24 h lang 100 ng/ml EGF ausgesetzt, und die Expression von Integrin β1 und Rab25 wurde durch Western-Blotting überwacht ( 2 ). Bemerkenswerterweise nahm die Integrin-β1-Expression als Reaktion auf die EGF-Stimulation mit der Zeit zu, erreichte nach 16 h ihren Höhepunkt und nahm danach relativ zur β-Aktin-Kontrolle ab (p < 0,05 Fig. 2a, b). Ein ähnliches Ergebnis wurde für die Rab25-Expression gefunden, die ebenfalls als Reaktion auf die EGF-Behandlung zunahm (p < 0,05 Fig. 2a, c). Interessanterweise führte eine längere Exposition gegenüber EGF für 48 h zu einer signifikanten Abnahme der Integrin-β1-Expression im Vergleich zu den Grundwerten (p = 0,026 Fig. 3).

Expression von Integrin β1 und Rab25 in EGF-behandelten Zellen. ein Die Expression von Integrin β1 und Rab25 wurde in HCT116-Zellen untersucht, die mit 100 ng/ml EGF durch Western-Blotting stimuliert wurden. B, C Densitometrische Quantifizierung der in gezeigten Daten ein zum B Integrin β1 und C Rab25 (CTL Steuerung)

Integrin β1-Expression nach EGF-Stimulation für 48 h. ein Die Integrin-β1-Expression nach Stimulation mit 100 ng/ml EGF wurde durch Western-Blotting überwacht. B Densitometrische Quantifizierung der in gezeigten Daten ein (p = 0,026)

Auswirkungen der EGF-Behandlung auf den Handel und die Sekretion von Integrin β1

Um zu bestimmen, ob die EGF-Stimulation die Lokalisation von Integrin β1 veränderte, wurden HCT116-Zellen mit 100 ng/ml EGF behandelt und dann einer subzellulären Fraktionierung und Western-Blot-Analyse unterzogen. Diese Ergebnisse zeigten, dass Integrin β1 fast ausschließlich in der Membranfraktion lokalisiert war und seine Expression als Reaktion auf die EGF-Behandlung nach 24 und 48 Stunden progressiv abnahm (p = 0,026 Fig. 4a). Da Integrin β1 in der zytosolischen Fraktion nicht nachgewiesen wurde, führten wir ELISA-Analysen mit Kulturmedien durch, die nach 48-stündiger Exposition gegenüber 100 ng/ml EGF gesammelt wurden. Als Ergebnis fanden wir einen Anstieg der Integrin-β1-Spiegel von 0,451 ng/ml in unbehandelten Kulturen auf 0,616 ng/ml nach 48 h EGF-Behandlung ( 4b ). Relative Veränderungen der Integrin-β1-Lokalisierung im Cytosol, der Membran und den Kulturüberständen sind in 4c gezeigt.

Analyse der Integrin-β1-Lokalisierung und -Ausscheidung. ein Die Lokalisation von Integrin β1 in der Membran und im Zytosol wurde durch subzelluläre Fraktionierung und Western-Blotting untersucht. B Die Integrin-β1-Ausscheidung wurde durch ELISA nach Stimulation mit EGF für 48 h überwacht. C EGF-abhängige Veränderungen der subzellulären Lokalisation von Integrin β1 wurden durch densitometrische Quantifizierung der in gezeigten Daten untersucht ein

Entsprechende Auswirkungen der Rab25-Expression und der EGF-Stimulation auf die Integrin-β1-Expression und den Handel

Als nächstes versuchten wir zu bestimmen, ob die Expression von Integrin β1 durch Rab25 reguliert wurde. Dazu transfizierten wir HCT116 Dickdarmkrebszellen mit Rab25-spezifischer siRNA und bestätigten einen ausreichenden Knockdown durch Western Blotting (Abb. 5a). Eine anschließende Analyse der Integrin-β1-Spiegel zeigte eine signifikante Abnahme nach dem Rab25-Knockdown (p = 0,003 Abb. 5b). Darüber hinaus zeigte die Membran/Zytosol-Fraktionierung, dass, obwohl Integrin β1 im Zytoplasma immer noch nicht nachweisbar war, nach 24 h EGF-Behandlung ein deutlicher Anstieg in der Membranfraktion auftrat (p = 0,001) ( 5c ).

Veränderungen der Integrin-β1-Lokalisierung nach Rab25-Knockdown. ein Die Expression von Integrin β1 und Rab25 wurde nach der Fraktionierung durch Western-Blotting überwacht. B Densitometrische Quantifizierung der Integrin-β1-Expression in Mock- und Rab25-Knockdown-Zellen. C Densitometrische Quantifizierung der in gezeigten Daten ein (CTL Steuerung)

Eine weitere densitometrische Analyse wurde durchgeführt, um die Wirkungen der EGF-Stimulation und der Rab25-Expression auf die Integrin-β1-Lokalisierung zu bestimmen. Bemerkenswerterweise wurden die niedrigen Spiegel von Integrin β1 im Zytosol als Reaktion auf die EGF-Exposition weiter reduziert (p = 0,045), während ein gegenteiliger Effekt in EGF-behandelten Rab25-Knockdown-Zellen beobachtet wurde (p = 0,011 Abb. 6a). Darüber hinaus verringerte die EGF-Stimulation die Membran-Integrin-β1-Spiegel in Kontrollzellen (p < 0,001), jedoch wurde dies in Rab25-Knockdown-Zellen umgekehrt, wo die Integrin-β1-Spiegel in der Membran nach der EGF-Behandlung anstiegen (p = 0,001) ( 6b ).

Veränderungen der Integrin-β1-Expression als Reaktion auf EGF-Stimulation und Rab25-Knockdown. ein, B Relative Verteilung von Integrin β1 in ein Zytosol und B Membran nach EGF-Stimulation in der Kontrolle (CTL Kontrolle, durchgezogene Linie) und Rab25-Knockdown (siRab25, gepunktete Linie) Zellen


Abschluss

In dieser Rezension wurde die gegensätzliche Natur von β . untersucht2 Integrin pro- und entzündungshemmende Funktionen in drei Hauptimmunfunktionen, was sie zu Hauptkandidaten macht, um sowohl wichtige Mediatoren als auch Regulatoren des Immunsystems zu sein. Die erste ist die Migration, die eine gezielte Rekrutierung von Immunzellen an Infektions- und Gewebeschäden ermöglicht. Die zweite ist die Adhäsion, die nicht nur der Extravasation von Immunzellen an Entzündungsherden vorausgeht, sondern auch ein wichtiger Faktor bei der Initiierung der adaptiven Immunantwort durch die Erleichterung zellulärer Interaktionen ist. Schließlich die Signalübertragung von Immunzellen, die eine fein abgestimmte Zusammenarbeit zwischen einer Vielzahl von Immunzellen ermöglicht. In Anbetracht der Tatsache, dass β2 Integrine spielen eine komplexe Rolle in drei wichtigen Bereichen des Immunsystems und ihre unterschiedliche Expression auf Monozyten, Makrophagen und DCs, wird deutlich, dass die Vielfalt der in dieser Übersicht präsentierten Studien keineswegs vollständig ist. Die gemeinsame Botschaft ist offensichtlich: β2 Integrine sind an komplexen immunregulatorischen Signalwegen beteiligt. Zusätzlich zu ihrer gut etablierten entzündungsfördernden Rolle bei der Rekrutierung und Aktivierung, β2 Integrine haben auch wesentliche immunregulatorische Funktionen. Eine fehlregulierte Integrin-Signalgebung, -Expression und -Oberflächenaktivierung trägt daher wahrscheinlich zu einer Vielzahl von Entzündungs- und Autoimmunerkrankungen bei. Erläuterung der Funktion von β2 Integrine versprechen daher weiterhin neue therapeutische Angriffspunkte für verschiedene Erkrankungen, wofür RA nur ein Beispiel ist.


4 SCHLUSSFOLGERUNGEN UND PERSPEKTIVEN

Insgesamt nehmen GPCRs an jedem Aspekt der epidermalen Stammzellbiologie teil, behalten die Identität von adulten epithelialen Stammzellen bei, koordinieren die Interaktionen von Stammzellen mit ihrer Nische und integrieren extrinsische Signale, um Stammzellen bei der Anpassung an Umweltveränderungen zu unterstützen. Während wir uns bemüht haben, die Wirkung von GPCRs und Liganden mit der Regulation von Stammzellen zu verknüpfen, ist es offensichtlich, dass spezifischere Modelle, in denen GPCRs in bestimmten Stammzellkompartimenten ausgeknockt oder überexprimiert werden, benötigt werden, um den Beitrag von Rezeptoren zum Stammzellschicksal zu analysieren. Eine empfindlichere Einzelzellanalyse, die schwach exprimierte Gene erkennt, würde unser Verständnis des Pools von GPCRs, die in jedem epidermalen Stammzellkompartiment exprimiert werden, erheblich verbessern. Aufgrund der Unterschiede in der Hautstruktur, Immunmodulatoren und GPCR-Genen, die für jede Spezies spezifisch sind, sind auch weitere Fortschritte bei der Validierung von Mausmodellen zur Biologie der menschlichen Haut erforderlich.

Obwohl wir uns in diesem Review auf die Rolle nichtsensorischer GPCRs konzentrierten, wurde gezeigt, dass Keratinozyten sensorische Rezeptoren wie lichtaktivierte Opsine exprimieren. 112 Darüber hinaus aktivieren zahlreiche Nährstoffe und mikrobielle Metaboliten GPCRs, 113 was darauf hindeutet, dass diese Rezeptorfamilie als Bindeglied zwischen Ernährung, Mikrobiom und somatischen Stammzellen fungieren könnte.Die genaue Rolle von GPCRs bei der Übertragung von Licht-, Nahrungs- und Mikrobiom-Hinweisen zur Koordination des Schicksals von epithelialen Stammzellen ist ein spannendes und noch wenig erforschtes Gebiet. Ein weiterer faszinierender Aspekt der GPCR-Signalgebung ist ihre Rolle bei der Regulierung der Tumorsuppression und -förderung. Zahlreiche GPCRs und heterotrimere G-Proteine ​​sind bei Krebs mutiert und cAMP spielt eine herausragende Rolle bei der Modulation von Signalwegen, die sich mit der Tumorprogression überschneiden, einschließlich Prostaglandin-, Hedgehog- und Hippo-Signalgebung. Weitere Forschungen zu den spezifischen GPCRs, Signalpartnern und beteiligten Zellen werden dazu beitragen, therapeutische Strategien zu entwickeln, die auf intrinsische Stammespfade abzielen, die mit maligner Transformation und Tumorwachstum verbunden sind.

Obwohl GPCR-Signale vorübergehend sind und zahlreiche Signalwege gleichzeitig aktiviert werden, um Rezeptoren zu desensibilisieren und intrazelluläre Kaskaden zu beenden, haben diese vorübergehenden Signale schließlich lang anhaltende Auswirkungen auf das Schicksal von epithelialen Stammzellen. Ein besseres Verständnis des Zusammenspiels der GPCR-Signalgebung mit der transkriptionellen und epigenetischen Regulation wird wichtige Einblicke in die Mechanismen liefern, die an der Aufrechterhaltung der Stammzellidentität beteiligt sind, und über die Ansätze, die Stammzellen verwenden, um auf Veränderungen der Mikroumgebung zu reagieren und sich anzupassen.


Schau das Video: White Blood Cells WBCs. Your bodys Defense. Hematology (Dezember 2022).