Information

Moderne Immunologie-Lehrbücher

Moderne Immunologie-Lehrbücher


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Ich suche Empfehlungen zu guten Lehrbüchern zur Einführung in die moderne Immunologie. Übersichtsartikel, vorzugsweise moderne (nach 2000) wären ebenfalls nützlich.

Bitte fügen Sie jeder Buchempfehlung einen kurzen Kommentar bei.

Fragen zu Buchlistings zu SE: Mir ist bekannt, dass SE-Sites im Allgemeinen im letzten Jahr eine Richtlinie gegen Fragen zu Bucheinträgen eingeführt haben. Stattdessen sollten Buchlisten in Tag-Wikis verschoben werden. Da BiologySE jedoch noch Beta und jung ist und das Tag-Wiki für Immunologie größtenteils leer ist, würden wir meiner Meinung nach zumindest vorübergehend von einer Frage profitieren, die gute Einführungsbücher in die moderne Immunologie auflistet. Schließlich, wenn Biology.SE ausgereift ist, sollte diese Frage geschlossen oder gesperrt und die Buchempfehlungen hierin in das Tag-Wiki für Immunologie verschoben werden. Darüber hinaus sammeln die Tag-Wikis für die meisten anderen SE-Sites, die ich gesehen habe, normalerweise Informationen, die zuerst in Fragen wie dieser auftauchten, selbst wenn die Frage schließlich geschlossen oder gesperrt wird. Deshalb denke ich, dass diese Frage zumindest vorübergehend für die Community nützlich sein wird.


Ich bin überrascht, dass Janeways Immunbiologie hier nicht aufgeführt ist:

Murphy K. Janeways Immunbiologie. 8. Aufl. New York: Girlandenwissenschaft; 2011.

Es ist sehr umfassend, zugänglich und geht über jeden mir bekannten Studiengang hinaus. Die meisten Immunologen, die ich kenne, haben irgendwo in ihrem Büro eine Kopie davon griffbereit. Ein besonderes Highlight sind die sehr übersichtliche Darstellung.

Ich vermute, dass gerade eine Neuauflage in Arbeit ist, daher empfehle ich vor dem Kauf zu prüfen, ob eine Neuauflage erscheinen wird.


Zelluläre und molekulare Immunologie
Abul K. Abbas MBBS (Autor), Andrew H. H. Lichtman MD PhD (Autor), Shiv Pillai MD (Autor)

Dies war mein Grundlagentext zur Immunologie vom Herbst 2011 für eine Hybrid-Medizin-/Grundstufe an meiner Universität.

Ich habe andere nicht gelesen, aber jedes Mal, wenn das Thema Immunantworten in anderen Undergrad-Kursen auftaucht, bin ich deswegen gut oder überaus informiert.


Das Buch des MCM ist gut. Ich empfehle das Buch BRS Mikrobiologie und Immunologie, denn dann sieht man die Sache im realen Kontext und hat auch gute Übungen. Erste Hilfe für die USMLES Schritt 1 erklärt Ihnen dann, wie man für Immunologie liest und gibt Ihnen eine ziemlich gute Zusammenfassung des Themas und einige Merkwörter.


Ich habe vor ein paar Jahren zum Spaß einen Immunologie-Studentenkurs besucht, während ich an einer Universität arbeitete (gelehrt von einem Ph.D. vom MIT).

"The Immune System" von Peter Parham (3. Aufl. 2009) hat wirklich Spaß gemacht und scheint mich gut gelehrt zu haben. So gut, dass ich, obwohl ich sehr wenig Hintergrund in Biologie hatte, nach diesem Kurs in der Lage war, meine (damals) Freundin in ihrem Immunologie-Abschlusskurs zu diskutieren und manchmal sogar zu helfen. Ich lobe das Buch sehr.

https://www.amazon.com/Immune-System-4th-Peter-Parham/dp/081534466X

edit: Anscheinend gibt es jetzt eine 4. Auflage, 2014.


Die moderne Immunologie beruht stark auf der Verwendung von Antikörpern als hochspezifische Laborreagenzien. Die Diagnose von Infektionskrankheiten, der erfolgreiche Verlauf von Transfusionen und Transplantationen sowie die Verfügbarkeit biochemischer und hämatologischer Assays mit außergewöhnlicher Spezifität und Sensitivität belegen den Wert des Antikörpernachweises.

Immunologische Verfahren werden bei der Behandlung und Vorbeugung von Infektionskrankheiten und bei der Vielzahl immunvermittelter Erkrankungen eingesetzt. Fortschritte in der diagnostischen Immunologie werden weitgehend durch Instrumentierung, Automatisierung und die Implementierung weniger komplexer und standardisierter Verfahren vorangetrieben. Beispiele für solche Prozesse sind wie folgt:

  • Miniaturisierung (Einsatz von Mikrotiterplatten zur Einsparung von Proben und Reagenzien),
  • amplifizierte Immunoassays (chemilumineszenter ELISA),
  • Durchflusszytometrie mit monoklonalen Antikörpern,
  • Immunglobuline,
  • molekulare Methoden (Polymerase-Kettenreaktionen).

Diese Methoden haben die Durchführung von Tests erleichtert und die Informationen, die von einem klinischen Labor entwickelt werden können, stark erweitert. Die Tests werden heute für die klinische Diagnose und die Überwachung von Therapien und Patientenreaktionen verwendet. Die Immunologie ist eine relativ junge Wissenschaft und es gibt noch so viel zu entdecken. Immunologen arbeiten heute in vielen verschiedenen Krankheitsbereichen, darunter Allergie, Autoimmunität, Immunschwäche, Transplantation und Krebs.

Interessanterweise stellen die Impfstoffentwicklung und das Verständnis der Funktionsweise von Impfstoffen unabhängig von den Fachgebieten die größten Herausforderungen dar. Die derzeit eingesetzten Impfstoffe erzeugen in erster Linie eine Antikörperantwort, die frei bewegliche Krankheitserreger, aber keine Bakterien und Viren wie das Humane Immunschwächevirus (HIV) bekämpfen kann. In der Krebsforschung werden Impfstoffe, die das Immunsystem dazu anregen, Tumorzellen anzugreifen, in klinischen Studien getestet.

Abbildung: Antikörperskulptur: Angel of the West ist eine Skulptur von Julian Voss-Andreae, die auf der Antikörperstruktur basiert.


Immunologie: Schleimhaut- und Körperoberflächenabwehr

Die überwiegende Mehrheit der medizinisch wichtigen Krankheitserreger infiziert ihren Wirt über eine Körperoberfläche wie die Haut oder über ein Schleimhautgewebe wie die Atemwege oder den Darm, da diese Stellen der äußeren Umgebung ausgesetzt sind. Durch den Fokus auf Immunität an Schleimhaut- und Körperoberflächen präsentiert dieses Buch einen frischen, neuen Ansatz für die Lehre der Immunologie.

Nach einer Einführung in die Grundstruktur des Immunsystems befasst sich das Buch mit zwei wichtigen Familien von Signalmolekülen: Zytokinen und Chemokinen, bevor es auf die Funktionsweise des mukosalen Immunsystems eingegangen wird. Es geht weiter mit der Untersuchung der Immunität gegen die vier Hauptgruppen von Krankheitserregern – Viren, Bakterien, Pilze und Parasiten – und schließt mit der Untersuchung von Erkrankungen des Immunsystems, der Immunologie von Schleimhauttumoren und dem Impfprozess.

  • Eine frische, neue Herangehensweise an das Thema mit Fokus auf Schleimhaut und Körperoberflächen.
  • Beschreibt das mukosale Immunsystem des Magen-Darm-, Atem- und Urogenitaltraktes sowie der Haut.
  • Beschreibt die wichtige Rolle von Zytokinen und Chemokinen bei einer Immunantwort.
  • Separate Kapitel, die der Immunität gegen Viren, Bakterien, Pilze und Parasiten gewidmet sind.
  • Enthält Kapitelzusammenfassungen, Boxen mit Themen von besonderem Interesse und ein umfangreiches Glossar.
  • Klar geschrieben und durchgehend in Farbe illustriert.

Studenten aus einer Reihe von Disziplinen, darunter Biologie, Biochemie, Biomedizin, Medizin und Veterinärwissenschaften, werden dieses Buch von unschätzbarem Wert finden, sowohl als Einführung in die grundlegende Immunologie als auch als Leitfaden für die Immunabwehrmechanismen der Schleimhäute.

Bewertungen

„Insgesamt ist das Buch gut geschrieben und die Konzepte werden anschaulich erklärt, mit gut illustrierten, informativen Abbildungen und Diagrammen. Ein 11-seitiges Glossar unterstützt diesen Text. Zusammenfassend: Empfohlen. Absolventen der Oberstufe und darüber.“ (Auswahl, 1. August 2012)


Inhaltsverzeichnis

1. Einführung in grundlegende Konzepte der Immunologie 2. Überblick über die mechanistische Modellierung: Techniken, Approximationen und Annahmen 3. Die Grundlagen der statistischen Datenanalyse 4. Verwendung von Daten zur Modellkonstruktion: Anwendung der Hauptkomponentenanalyse und verwandter Methoden in der Immunologieforschung 5 Eine Einführung in die regelbasierte Modellierung der Signalübertragung von Immunrezeptoren 6. Boolesche Modelle in der Immunologie 7. Von der evolutionären Berechnung zu phänotypischen Spandrels: inverses Problem der Immunligandenerkennung 8. Zen und die Kunst der Parameterschätzung in der Systembiologie 9. Räumliche Kinetik in Immunologische Modellierung 10. Analyse und Modellierung von Einzelzelldaten 11. Quantifizierung der Lymphozytenrezeptordiversität 12. Antigenrezeptordiversifizierung während Immunantworten 13. Quantitative Modellierung der Mastzellsignalübertragung 14. Physikalische Modelle der Immunsignalübertragung 15. Populationsdynamik von Wirt und Pathogenen 16. Virale Fitnesslandschaften: Eine physikalisch-wissenschaftliche Perspektive 17. Eine Wunschliste für Models g immunologische Synapsen


Was sagen Philosophen zur Immunologie und inwiefern kann diese für Immunologen nützlich sein? Ein bemerkenswertes Merkmal der modernen Immunologie ist, dass sie ein stark von der Philosophie beeinflusstes Vokabular verwendet. Vor allem die philosophischen Konzepte von „Selbst“ und „Nicht-Selbst“ spielen in der Immunologie seit den 1940er Jahren eine zentrale Rolle. Wenn wir über dieses Vokabular nachdenken, können wir besser verstehen, warum es angenommen wurde, welche Annahmen zugrunde liegen und ob es im Lichte des heutigen Wissens über die Immunologie beibehalten oder überarbeitet werden sollte.

In diesem Artikel zeige ich, wie ein philosophischer Ansatz zwei Schlüsselaspekte der aktuellen Immunologie beleuchten kann. Die erste ist die biologische Individualität: Was definiert die Einheit, Grenzen, Einzigartigkeit und Beständigkeit eines Lebewesens laut Immunologie, insbesondere im Zusammenhang mit dem, was wir über die Interaktionen zwischen Mikrobiota und Immunsystem lernen? Der zweite Aspekt ist die Immunogenität, dh die Fähigkeit bestimmter Einheiten, eine Effektor-Immunantwort auszulösen, die ein Ziel zerstört.

Immunologische Individualität

Unsere Faszination für die biologische Individualität geht auf Aristoteles zurück, möglicherweise schon früher, und war seit dem Ende des 19. Jahrhunderts ein zentrales Thema der Immunologie (Medawar, 1957, Richet, 1894). Die grundlegende Frage, die die Reflexionen über die biologische Individualität aufwerfen, ist, was ein Lebewesen zu einer zusammenhängenden, relativ klar abgegrenzten und oft einzigartigen Einheit macht, die trotz ständiger Veränderung im Laufe der Zeit „gleich“ bleibt (Santelices, 1999 West et al., 2015). Biologische Individualität ist insofern relativ, als sie von der gestellten Frage abhängt. Darüber hinaus erfolgt sie graduell, insofern die vier Hauptelemente der biologischen Individualität – Zusammenhalt, Abgrenzung, Einzigartigkeit und Beständigkeit – in einem Lebewesen auf verschiedenen Ebenen ausgedrückt werden können (Pradeu, 2016 Santelices, 1999).

Die Immunologie ist zwar nicht das einzige Wissenschaftsgebiet, das sich mit der Frage der biologischen Individualität beschäftigt, leistet aber einen wesentlichen Beitrag zu dieser Frage. Das Immunsystem spielt eine Schlüsselrolle bei der Überwachung jedes Teils des Organismus und der Aufrechterhaltung des Zusammenhalts zwischen den Komponenten dieses Organismus, wodurch jedes Individuum einzigartig wird und die Grenzen zwischen dem Organismus und seiner Umwelt ständig neu festgelegt werden (Pradeu, 2012).

Die Frage nach dem Selbst-Nicht-Selbst ist für die Definition biologischer Individualität besonders relevant und wurde stark von dem australischen Virologen Macfarlane Burnet (Tauber, 1994) geprägt. Seine konzeptionellen und theoretischen Reflexionen über das Selbst und das Nicht-Selbst (inspiriert von der Philosophie) wurden später von einer großen Mehrheit der Immunologen übernommen. Burnet schlug vor, dass jede dem Organismus fremde Entität vom Immunsystem abgestoßen wird, während jede Entität, die aus diesem Organismus stammt, keine Immunantwort auslöst (Burnet, 1969). Dieser Rahmen ermöglichte es, verschiedene Immunreaktionen zu berücksichtigen, von Krankheitserregern bis hin zu Transplantaten.

Burnet betrachtete die Immunologie eher als ein philosophisches Problem als als ein wissenschaftliches und wurde stark von dem Mathematiker und Philosophen Alfred North Whitehead beeinflusst, der dem Begriff des Selbst eine zentrale Rolle in seiner Philosophie eingeräumt hatte (Anderson und Mackay, 2014). . Der Dialog zwischen Immunologen und Philosophen wird seitdem fortgesetzt: Immunologen übernehmen Konzepte aus der Philosophie, insbesondere wenn sie über das Thema Individualität nachdenken, und umgekehrt nutzen viele Philosophen die Immunologie als wichtige Inspirationsquelle (Cohen, 2009).

Philosophen haben unser Verständnis dafür verbessert, wie der konzeptionelle Rahmen des Selbst-Nicht-Selbst aufgebaut wurde, und halfen dabei, seine theoretischen und empirischen Grundlagen in Frage zu stellen (Pradeu, 2012 Swiatczak und Rescigno, 2012 Tauber, 1994). Seit den 1990er Jahren gesammelte wissenschaftliche Daten haben gezeigt, dass das Immunsystem auch auf körpereigene Komponenten, also auf das Selbst, reagiert. Tatsächlich ist ein signifikantes Maß an Autoreaktivität und Autoimmunität für ein gesundes Immunsystem unabdingbar. Immunreaktionen wie die Phagozytose abgestorbener Zellen, Gewebereparatur und regulatorische Reaktionen sind in den meisten Fällen Reaktionen auf das Selbst (Rankin und Artis, 2018). Darüber hinaus ist mittlerweile klar, dass viele fremde Entitäten, wie zum Beispiel mikrobielle Gemeinschaften (bekannt als Mikrobiota), vom Immunsystem aktiv toleriert und nicht eliminiert werden (Chu und Mazmanian, 2013).

Diese Entwicklungen haben viele zu dem Schluss geführt, dass das Selbst-Nicht-Selbst-Framework überdacht werden sollte und dass wir von einer internalistischen Sichtweise (die das Individuum als isoliert, autonom und endogen gebaut betrachtet) zu einer eher interaktionistischen Sichtweise (die einen Organismus als ein Ökosystem, das ständig mit seiner Umwelt interagiert McFall-Ngai et al., 2013). Obwohl die biologische Individualität eine Schlüsselfrage in der Immunologie bleibt, hat sich die Sichtweise von Wissenschaftlern geändert: Der Begriff des Selbst-Nicht-Selbst hat sich zu der Idee eines Individuums aus heterogenen Elementen mit ständig neu definierten Grenzen entwickelt, in dem das Immunsystem nicht nur die Elemente, mit denen es interagiert, eliminieren, aber auch aktiv tolerieren (Abbildung 1 Pradeu, 2012).

Wie die Immunologie ein biologisches Individuum definiert.

Gemäß dem „Selbst-Nicht-Selbst“-Rahmen (links) ist das Immunsystem hauptsächlich ein System zum Angreifen und Abtöten von Fremdkörpern. Schnittstellen wie das Darmlumen gehören zum „Außen“ des Organismus, und die Grenzen sind fest und fest. Gemäß dem neu entstehenden „immunologischen Individuum“ (rechts) kann das Immunsystem Eigen- und Fremdelemente eliminieren, es kann Eigen- und Fremdelemente tolerieren, aber es stärkt auch den Zusammenhalt zwischen den Körperbestandteilen. In diesem Rahmen werden Grenzen durch das Wirken des Immunsystems ständig neu definiert. Bildnachweis: Wiebke Bretting (CC BY 4.0).

Immunogenität

Das Selbst-Nicht-Selbst-Framework bietet auch eine Erklärung der Immunogenität, dh wie eine Effektor-Immunantwort (eine Reaktion, die zur Eliminierung oder Neutralisierung eines Ziels führt) aktiviert wird. Einige Hypothesen, wie die „Gefahrentheorie“, legen nahe, dass das Immunsystem nicht zwischen Selbst und Nicht-Selbst unterscheidet, sondern zwischen Dingen, die Schaden anrichten, und solchen, die dies nicht tun (Matzinger, 1994). Zusammen mit anderen Immunologen schlage ich jedoch eine andere Alternative vor: die Diskontinuitätstheorie der Immunität (Pradeu et al., 2013, Pradeu und Carosella, 2006).

Die Diskontinuitätstheorie schlägt vor, dass Effektor-Immunantworten durch plötzliche Veränderungen der molekularen Motive ausgelöst werden, die mit den Rezeptoren des Immunsystems interagieren (z. B. Mustererkennungsrezeptoren, NK-Zellrezeptoren, B-Zellrezeptoren, T-Zellrezeptoren und Zytokinrezeptoren). Im Gegensatz dazu löst ein persistentes Motiv oder ein langsam erscheinendes Motiv keine Effektorantwort aus, sondern führt eher zu einer tolerogenen Immunantwort (wo ein Ziel eher akzeptiert als eliminiert wird). Raum und Zeit sind in der Diskontinuitätstheorie wichtig: Die überwiegende Mehrheit der Immunreaktionen findet in Geweben statt im Blut statt, und verschiedene Gewebe haben unterschiedliche Grundlinien der Immunaktivierung, daher muss jede Theorie der Immunreaktion die gewebespezifischen . berücksichtigen Art der Antwort.

Eine Immunantwort kann auf alle möglichen plötzlichen Veränderungen zurückzuführen sein und könnte mit der Erkennung von Motiven und/oder Veränderungen des Immunsystems zusammenhängen (wie die Migration von Motiven oder Immunzellen von einem Gewebe in ein anderes oder das schnelle Auftreten von ein Krankheitserreger oder ein Tumor). Was die Diskontinuitätstheorie klar von der Selbst-Nicht-Selbst-Theorie unterscheidet, ist, dass das Kriterium der Immunogenität nicht der Ursprung des Antigens ist (wie es im Selbst-Nicht-Selbst-Rahmen der Fall ist), sondern die Geschwindigkeit der Veränderung im relevanten Gewebe ( Tabelle 1). Daher werden anhaltende oder langsam erscheinende „Selbstmotive“ vom Immunsystem toleriert, während schnell erscheinende „Selbstmotive“ eine Effektorantwort verursachen.

Verschiedene Theorien der Immunogenität.

Die Selbst-Nicht-Selbst-Theorie und die Diskontinuitätstheorie der Immunität sagen die gleichen Ergebnisse für anhaltende oder sich langsam ändernde endogene (Selbst-)Elemente und auch für plötzlich auftretende und/oder sich schnell ändernde exogene (Nicht-Selbst-)Elemente voraus. Die Theorien machen unterschiedliche Vorhersagen für sich schnell ändernde endogene Elemente und für persistente oder sich langsam ändernde exogene Elemente.

MotiveBeispieleSelbst-Nicht-Selbst-TheorieDiskontinuitätstheorie
Schnell wechselnde körpereigene Elemente- Einige bedeutende körperliche Veränderungen, wenn sie unkontrolliert sind (z. B. Pubertät, Metamorphose, Schwangerschaft)tolerogene ReaktionEffektorantwort
Persistente oder sich langsam ändernde körpereigene Elemente- Gewöhnliche Funktion des Körperstolerogene Reaktiontolerogene Reaktion
Persistente oder sich langsam ändernde exogene Elemente- Viele Bestandteile der Mikrobiota, die während der Ontogenese früh erworben wurden
- Chronische Viren
Effektorantworttolerogene Reaktion
Plötzlich auftretende und/oder sich schnell ändernde exogene Elemente- Mikroorganismen, die plötzlich in den Organismus eindringen
- Die meisten Transplantate
EffektorantwortEffektorantwort

Dies könnte für den Bereich der Onkoimmunologie relevant sein (Ribas und Wolchok, 2018, Pauken und Wherry, 2015). Die Diskontinuitätstheorie sagt beispielsweise voraus, dass ein langsam wachsender Tumor eine tolerogene Immunantwort auslöst, während ein schnell wachsender Tumor (oder ein Tumor in einer sich schnell verändernden Mikroumgebung) eine Effektorantwort auslöst. Die Diskontinuitätstheorie wurde auch verwendet, um eine Reihe verschiedener Themen zu beleuchten, darunter die Auswirkungen von Chemotherapeutika auf die Immunmodulation bei Krebs (Hodge et al., 2013), die ständige „Ausbildung“ natürlicher Killerzellen, um die Toleranz des Körpers sicherzustellen Inhaltsstoffe (Boudreau und Hsu, 2018), wiederholte Impfungen bei immungeschwächten Personen (Rinaldi et al., 2014) und mathematische Modelle der Immunaktivierung (Sontag, 2017). Abhängig von zukünftigen experimentellen Ergebnissen wird diese Theorie bereichert, revidiert oder vielleicht aufgegeben.

Abschluss

Die Immunologie ist eines der theoretischsten und philosophischsten Gebiete innerhalb der Lebenswissenschaften, und die laufenden Dialoge zwischen Immunologen und Philosophen werden wahrscheinlich fortgesetzt. Die Liste der diskussionswürdigen Fragen umfasst die folgenden: i) Wie können wir die verschiedenen Arten und Ebenen der Erklärung in der Immunologie (vom Molekül bis zum System) zu einem integrativen Rahmen kombinieren? ii) Welche Prinzipien sollte man anwenden, um zufriedenstellende und fruchtbare Klassifikationen von Immunkomponenten anzubieten (Mantovani, 2016)? iii) Wie kann die Immunologie durch Beiträge aus anderen Bereichen der Biologie und darüber hinaus (einschließlich Physik und Informatik) bereichert werden? iv) Kann man Immunologie und Immunologie definieren? Inzwischen ist klar, dass das Immunsystem neben der Abwehr von Krankheitserregern noch viele andere Aufgaben übernimmt: Es ist beispielsweise an der Entwicklung und Gewebereparatur beteiligt. Da das Gebiet der Immunologie breiter geworden ist (sofern es sich mit vielen Bereichen der Physiologie überschneidet), verschwimmen seine Grenzen (Rankin und Artis, 2018 Truchetet und Pradeu, 2018). Für diese und viele andere Herausforderungen scheint eine enge Allianz zwischen Philosophen, Biologen und Medizinern vielversprechend.


Studentenausgabe der modernen Biologie

"Schnäppchenbücher" sind brandneue Artikel, die aufgrund des Versands oder der Handhabung geringfügige physische Mängel aufweisen, die die Verwendung des Artikels nicht beeinträchtigen. Alle Schnäppchen-Bücher werden so wie sie sind verkauft und alle Verkäufe sind endgültig (keine Rückgabe, Umtausch oder Stornierung). Schnäppchenbücher verbleiben bis zu 12 Stunden im Warenkorb und werden dann entfernt, wenn die Bestellung nicht abgeschlossen wird. Bestellungen, die aus regulären und Schnäppchenartikeln bestehen, können per Kreditkarte oder PayPal gekauft werden und werden zusammen (mit zwei Lieferscheinen) versendet.

Dieser Artikel ist ein digitale Download-Datei und ist nicht ein gedrucktes oder physisches Produkt. Nach Abschluss des Checkouts erhalten Sie eine E-Mail mit einem Link, über den Sie die Datei herunterladen und auf Ihrem lokalen Gerät speichern können. Bitte beachten Sie, dass E-Books und andere digitale Medien-Downloads vom Umtausch ausgeschlossen sind und alle Verkäufe endgültig sind.

Produktbeschreibung:

Dieses weltliche Lehrbuch bietet ein umfassendes Studium der grundlegenden Konzepte und des Vokabulars der Biologie und ist das zentrale Lehrbuch der Memoria Press Moderne Biologie Kurs. Der vollständig illustrierte Text enthält 51 Kapitel zu den Grundlagen der Biologie, Zellbiologie, Genetik und Biotechnologie, Evolution, Ökologie, Mikrobiologie, Pflanzen, Tiere und Humanbiologie. Textliche Informationen werden anschaulich erklärt und leisten einen guten Job, um komplexere Themen verständlich zu machen. Jedes Kapitel enthält Abschnittsreviews, Kapitelhighlights und -reviews sowie standardisierte Fragen zur Testvorbereitung. Außer den Antworten der Abschnittsübersicht im Kurs Memoria Press ist kein Antwortschlüssel verfügbar. Über den gesamten Text verteilt sind „Quick Labs“ und Chapter Inquiry Labs, die praktische Erfahrungen bieten. Es sind keine Laborkits verfügbar, und Material muss im Voraus mit ein wenig Recherche und Planung bei den Eltern oder Lehrern gekauft werden. Familien können auch erwägen, die Illustrierter Leitfaden für Heimbiologie-Experimente (Artikel #061896) oder Erfahrungen in Biologie (Artikel-Nr. 013095), um den Laborwissenschaftskredit bereitzustellen. Beide Optionen ermöglichen eine einfache Durchführung in wissenschaftlichen Labors zu Hause. Weitere Informationen und Listen des erforderlichen Laborbedarfs finden Sie in den einzelnen Produktbeschreibungen. Das Lehrbuch enthält auch einen umfangreichen Anhang mit ausführlichen Anleitungen für sichere Laborpraktiken, wie man ein zusammengesetztes Mikroskop verwendet, einen Biologenleitfaden zum Periodensystem, eine Klassifizierung und mehr. Als interaktive Online-Ausgabe betrachtet, sind leider viele der Online-Ressourcen nicht mehr verfügbar, mit Ausnahme der SciLinks von NSTA. Ich konnte kostenlos ein Studentenkonto erstellen und die referenzierten Links mit den im Text gefundenen Schlüsselwörtern finden. Während der in Memoria Press verwendete Kerntext Moderne Biologie, können auch andere Familien dies als soliden Biologiekurs empfinden, um den Bedürfnissen ihrer Gymnasiasten gerecht zu werden. Bei Verwendung zusätzlich zu den hervorragenden Materialien von Memoria Press müssen Eltern/Lehrer Antworten auf die Fragen im Text finden und/oder ihre eigenen Bewertungstools erstellen, um sicherzustellen, dass die Schüler lernen. 1128 Seiten, hc.

Beschreibung des Herausgebers:

Gebundener Schülertext, der den Bedürfnissen von Schülern und Lehrern entspricht, die einen umfassenden phylogenetischen Ansatz für den Biologieunterricht wünschen.

Erfüllung der Bedürfnisse von Gymnasiasten, Moderne Biologie von Memoria Press Der Studiengang fördert die Beherrschung der Grundbegriffe der Biologie. Basierend auf der Philosophie, dass der effektivste Weg zum Erlernen eines Themas darin besteht, das Thema einzugrenzen und tief zu studieren, umfasst der Kurs 18 der 51 Kapitel des Lehrbuchs Moderne Biologie, was die entmutigenden 1100 Seiten viel überschaubarer macht! Obwohl dies „leicht“ erscheinen mag, deckt der Kurs alles ab, was für einen High-School-Biologie-Credit erforderlich ist. Thematisch verbringen die Schüler viel Zeit mit Mikrobiologie und Biochemie, mehr als in den meisten Biologiekursen auf High-School-Niveau. Darüber hinaus umfasst dieses Programm typisch gelehrte Konzepte wie Zellstruktur, Genetik, Struktur und Funktion von Pflanzen sowie Wirbeltieren und wirbellosen Tieren. Die Anatomie des Menschen ist nicht abgedeckt und gilt als Biologie-Kredit für das zweite Jahr. Memoria Press entwickelt jedoch derzeit seinen Kurs über die menschliche Anatomie und verwendet dabei die Text der modernen Biologie.

Es gibt zahlreiche erforderliche Ressourcen, um den Kurs erfolgreich zu nutzen, darunter die Moderne Biologie Lehrbuch, das Lehrerhandbuch, Schülerführer, Lehrvideos (gestreamt von der Memoria Press-Website), a Test Buch und der Princeton Review-Malbuch (Artikel-Nr. 004223). Im Rahmen des Programms sind keine Labore enthalten, das Lehrbuch enthält jedoch verschiedene Laboraktivitäten, die verwendet werden können, wenn die Eltern die empfohlenen Materialien finden. Wenn ein High-School-Laborkredit erforderlich ist, Illustrierter Leitfaden für Heimbiologie-Experimente (Artikel #061896) oder Erfahrungen in Biologie (Artikel-Nr. 013095) bietet Optionen für Laborwissenschaften, die einfach zu Hause zu absolvieren sind und thematisch zu den Lektionen passen. Sie sind im Unterricht nicht vorgesehen, daher müssen sich die Eltern einige Minuten Zeit nehmen, um den Unterricht mit den Experimenten für ihre Schüler abzugleichen. Das Lehrbuch stammt von einem weltlichen Verlag und enthält evolutionäre Inhalte.

Die Lehrerhandbuch bietet einen kurzen Überblick über die Verwendung des Kurses und gibt Antworten auf die Fragen zur Textüberprüfung sowie die Aktivitäten und Tests des Schülerleitfadens. Es vermerkt auch, welche der begleitenden Malbuchseiten ausgemalt werden sollen. Es sind keine zusätzlichen Unterrichtsnotizen enthalten, da das Programm auf den Videovorträgen für zusätzliche Erklärungen basiert. Die Lehrerhandbuch teilt den Kurs in Trimester mit der Erwartung ein, dass der Kurs in einem traditionellen Schuljahr abgeschlossen wird. Die erforderliche Streaming-Video-Lizenz hat eine Laufzeit von 13 Monaten, sodass die Schüler den Kurs flexibel abschließen können (bei Bedarf mit einer Verlängerung gegen eine zusätzliche Gebühr). Es sind keine Unterrichtspläne enthalten, obwohl tägliche Unterrichtspläne bei Bedarf separat erhältlich sind.

Das Verbrauchsmaterial Schülerführer bietet dem Schüler Raum, um Wortschatzwörter zu definieren, Diagramme zu beschriften und auf die Wiederholungs- und Verständnisfragen zu antworten.

Das Erforderliche Biologie Malbuch von Princeton Review (Artikel-Nr. 004223) hilft den Schülern, sich die biologischen Strukturen und Funktionen einzuprägen, was die Beherrschung und erfolgreiche Testdurchführung fördert.

Die Test Buch bietet einen Test für jedes Kapitel im Studentenhandbuch und eine umfassende 15-seitige Abschlussprüfung. Testfragen sind Multiple-Choice, Matching, kurze Antworten und ein Diagramm zum Beschriften. Antworten zu den Tests finden Sie in der Lehrerhandbuch. Das Testheft ist nicht reproduzierbar.

Die letzte Komponente, die Lehrvideos, bieten Vorträge an, die die Textinformationen erweitern. Die von der Highland Latin School Lehrerin Dr. Rebecca Shelburne unterrichteten Vorlesungen richten sich an den Schüler und sollen die Aufmerksamkeit des Schülers fesseln und halten. Die Videovorträge sind in Lehrbuchabschnitte mit unterschiedlicher Länge von knapp 10 Minuten bis 49 Minuten unterteilt. Laut Memoria Press wird Evolution zwar angesprochen, aber nie als Makroprozess gelehrt. Die Mikroevolution wird durchgehend diskutiert, da sie sich nur auf Veränderungen innerhalb der Arten bezieht. Gelegentliche Hinweise auf Gott finden sich in der gesamten Videoanleitung, aber Kreationismus wird nicht gelehrt. Wenn Sie die Streaming-Videoanleitung im Rainbow Resource Center kaufen, erhalten Sie eine E-Mail mit Anweisungen zum Zugriff auf einen eindeutigen Weblink für die Streaming-Anleitung. Bitte erlauben Sie 1-2 Werktage, bis die E-Mail ankommt. Die Freischaltung beginnt mit dem Aufrufen des jeweiligen bereitgestellten Links.

Komponenten sind einzeln oder in a . erhältlich Paket, das das Lehrbuch, das Schülerarbeitsbuch, das Testbuch, das Lehrerhandbuch, das Biologie-Malbuch und die Streaming-Anleitungsvideos enthält.

Moderne Biologie ist eine ausgezeichnete Option für die Homeschool-Familie, die einen unabhängigen High-School-Wissenschaftskredit sucht. Wenn Sie Bedenken haben, dass der Kurs nur einen Teil des Lehrbuchs abdeckt, versichert Dr. Shelburne, dass Studenten, die den Kurs mit 90% oder mehr abschließen, gut auf die SAT-Biologie (Molekular)-Prüfung vorbereitet sein sollten.

Benutzerfreundlich, gut organisiert und wissenschaftlich fundiert, werden diese wissenschaftlichen Leitfäden von Memoria Press dem wissenschaftsliebenden Kind in Ihrem Zuhause sicher gefallen. Die Kurse bestehen aus einem Lehrerleitfaden, einem Schülerleitfaden und in einigen Fällen einem separaten Text. Für einige Kurse werden optionale Ressourcen vorgeschlagen.

Die in diesem Abschnitt aufgeführten Elemente sind in der Regel komplette naturwissenschaftliche Programme mit einer Lehrer- und Schülerkomponente, die neben naturwissenschaftlichen Materialien nur wenige Ergänzungen erfordern.


Einheit 2: Biologische Chemie

  • Modul 2: Atome, funktionelle Gruppen und Wasser
    • Nachdem sie sich mit der funktionellen Gruppierung von Molekülen befasst haben, sind die Studierenden in der Lage, verschiedene funktionelle Gruppen zu identifizieren und jede nach Kategorie (d. h. polar, unpolar, neutral oder geladen) zu charakterisieren.
    • Definieren Sie einen Puffer und seinen Nutzen für das biologische System.
    • Definieren Sie eine Wasserstoffbrücke und zeichnen Sie mögliche Wasserstoffbrücken zwischen zwei beliebigen geeigneten Molekülen.
    • Definieren und zeichnen Sie die Struktur einer Wasserstoffbrücke zwischen zwei beliebigen geeigneten Molekülen.
    • Definiere und zeichne die Struktur einer Wasserstoffbrücke zwischen zwei beliebigen geeigneten Molekülen.
    • Beschreiben Sie ein Beispiel für Bioselektivität, das sich aus der Struktur und Bindung von Kohlenstoff ergibt.
    • Beschreiben Sie, wie Wasser als Lösungsmittel die Struktur von Ionen in Lösung puffert.
    • Beschreiben Sie die Eigenschaften von Wasser, die es am besten geeignet machen, um lebende Systeme zu unterstützen.
    • Beschreiben Sie den Unterschied zwischen kovalenten und nicht-kovalenten Bindungen.
    • Beschreiben Sie die Energie, die mit dem Aufbrechen kovalenter und nicht-kovalenter Bindungen verbunden ist.
    • Beschreiben Sie die hydrophobe Wirkung und ihre Bedeutung in biologischen Systemen.
    • Beschreiben Sie die Eigenschaften von Wasser, die für die Unterstützung lebender Systeme entscheidend sind.
    • Beschreiben Sie die Ergebnisse des hydrophoben Effekts, d. h. die Wechselwirkung hydrophober Moleküle unter Ausschluss von Wasser.
    • Bestimmen Sie die Ladung an funktionellen Gruppen bei einem gegebenen pH-Wert.
    • Bestimmen Sie die Gesamtzahl der möglichen Wasserstoffbrückenbindungen von einem gegebenen elektronegativen Atom.
    • Unterscheiden Sie zwischen einem starken Elektrolyten und einem schwachen Elektrolyten.
    • Erklären Sie die Grundstruktur eines Wassermoleküls und wie es eine dreidimensionale Struktur bilden kann.
    • Erklären Sie die Bedeutung elektronegativer Atome in einem Molekül.
    • Identifizieren Sie verschiedene Funktionsgruppen und charakterisieren Sie jede nach Kategorie (d. h. polar/unpolar, geladen/ungeladen).
    • Identifizieren Sie die elektronegativen Atome in biologischen Systemen.
    • Identifizieren Sie das elektronegativere Atom, wenn Sie zwei Atome vergleichen.
    • Nennen Sie mindestens 4 der wichtigsten Spurenelemente, die in Zellen vorkommen, und den ionischen Zustand, in dem sie natürlich vorkommen.
    • Listen Sie Atome (Elemente) auf, die in biologischen Systemen vorkommen, die für das Leben am wichtigsten sind, einschließlich der häufigsten Atome und Spurenelemente.
    • Zählen Sie die sechs Hauptatome auf, die in der Zusammensetzung biologischer Systeme vorkommen, und beschreiben Sie die Eigenschaften, die sie für das Leben unverzichtbar machen.
    • Erkennen und beschreiben Sie eine kovalente und eine ionische Bindung strukturell.
    • Erkennen und beschreiben Sie eine kovalente Bindung und intermolekulare Kräfte (eine ionische, eine Wasserstoffbrücke und Van-der-Waals-Wechselwirkungen) sowohl strukturell als auch energetisch.
    • Erkennen und beschreiben Sie eine kovalente, eine ionische und eine Wasserstoffbrücke, sowohl strukturell als auch energetisch.
    • Definieren Sie einen schwachen Elektrolyten und schreiben Sie einen Ausdruck für die Gleichgewichtskonstante.
    • Beschreiben Sie die Dynamik des Gleichgewichts.
    • Beschreiben Sie den Zusammenhang zwischen pH-Wert und Protonenkonzentration.
    • Unterscheiden Sie Säuren von Basen und erklären Sie ihre Beziehung zur Säuredissoziation.
    • Erklären Sie die Beziehung zwischen der Konzentration von Säure und konjugierter Base im Gleichgewicht.
    • Nach Abschluss dieses Reviews werden die Schüler in der Lage sein, die Bedeutung von Ka und pKa zu beschreiben und die Beziehung zwischen ihnen zu erklären.
    • Nach der Untersuchung von Kohlenhydratmolekülen sind die Studierenden in der Lage, die drei Hauptfunktionen von Kohlenhydraten zu beschreiben.
    • Charakterisieren Sie die funktionellen Gruppen in Kohlenhydraten.
    • Definieren Sie eine glykosidische Bindung und die Beziehung zwischen Kondensation und Hydrolyse.
    • Definieren Sie die Kriterien für die Bildung einer glykosidischen Bindung.
    • Beschreiben Sie Kondensation und Hydrolyse.
    • Beschreiben Sie die anomeren Kohlenstoffe der Halbacetalform der Kohlenhydrate.
    • Bezeichnen Sie Funktionen für die im Text angegebenen Mono-, Di- und Polysaccharide.
    • Aldose (Aldehyde) von Ketosen (Ketonen) unterscheiden.
    • Distinguish and describe the differences between the plant cell wall and bacterial cell wall.
    • Distinguish between an aldose and a ketose.
    • Distinguish characteristic structural differences among homopolysaccharides.
    • Distinguish primary, secondary, tertiary, and quaternary structures.
    • Distinguish, and characterize the differences, between cellulose, starch and glycogen.
    • Explain alpha helix and beta structures.
    • Explain why all amino acids are the L-isomer and why glycine is not.
    • Explain why carbohydrates are well suited for signaling and cell recognition functions.
    • Identify a glycosidic bond.
    • Identify and describe characteristics of the molecules marked.
    • Identify asymmetric (chiral) centers.
    • Identify enantiomers of all carbohydrates as D.
    • Identify the basic structure of all amino acids.
    • Identify the molecules: glyceraldehyde, dihydroxyacetone, ribose, glucose, galactose and fructose.
    • Identify which steroisomer of carbohydrates are found in nature.
    • Illustrate the different types of bonding responsible for holding the tertiary structure of protein together.
    • Place any amino acid into one of the four categories of properties, based on the structure of its side chain.
    • Recognize a peptide (amide bond) and list the structural properties of it.
    • Recognize alpha and beta orientation of hydroxyl on anomeric carbon.
    • Recognize and describe structure and function of sucrose, lactose, cellulose, glycogen, amylose, amylopectin, and starch.
    • Recognize the anomeric carbon in the hemiacetal form of the carbohydrates.
    • Classify amino acid side chains based on polarity and ionization.
    • Define and describe the primary structure of a protein.
    • Define the driving force for the folding of a polypeptide in water and in a non-polar solvent.
    • Define the structural properties of a peptide bond that will put constraints on the folding of a protein.
    • Describe how a quaternary structure is dynamic.
    • Describe specific examples of secondary structure in detail.
    • Describe specific structural restrictions that characterize secondary structure.
    • Describe structural domains.
    • Describe the bonding involved in the folding of proteins.
    • Describe the type of reaction responsible for the formation anddegradation of the peptide bond.
    • Describe what is necessary to form a quaternary structure.
    • Explain how primary structure defines the final structure of a protein.
    • Explain the covalent bonds possible in stabilizing a tertiary structure.
    • Explain why most naturally occurring amino acids are the L-isomers and why glycine is not.
    • Give at least one example of a quaternary structure.
    • Identify and draw hydrogen bonding between peptide bonds.
    • Identify the basic structure of amino acids.
    • Identify the functional groups involved in formation of a peptide bond.
    • Define activation energy and the effect an enzyme hasupon it.
    • Define equilibrium binding and describe how it is dynamic.
    • Describe how pH affects enzyme kinetics.
    • Describe how temperature affects enzyme kinetics.
    • Describe the effect of changing ligand concentration on an equilibrium.
    • Describe the general reaction for an enzyme catalyzed reaction.
    • Describe the interactions that stabilize the protein-ligandcomplex.
    • Discern the difference between a ligand and a substrate.
    • Draw a graph of equilibrium binding.
    • Explain the parallels between protein-ligand binding and weak electrolyte dissociation.
    • Explain what happens before and after the formation of the ES complex.
    • Explain, and graphically illustrate, the effect of each inhibitor type on a velocity vs. substrate concentration graph: a) non-competitive and b) competitive.
    • Graphically represent the relationship, between each of the following, for an enzyme catalyzed reaction: 1) velocity and substrate concentration 2) velocity and enzyme concentration 3) velocity and pH and, 4) velocity and temperature.
    • Recognize, and describe, the reversible binding of proteins with their ligands.
    • Upon completion of this topic, students will be able to recognize, and describe, the reversible binding of proteins with their ligands.
    • Module 7: Lipids and Membranes
      • Define the amphipathic character of a phospholipid and glycolipid.
      • Define the functions of each of the classes of lipids.
      • Describe and diagram the characteristic features of the fluid mosaic membrane.
      • Describe and identify the difference between a liposome and a micelle.
      • Explain how the different structural features of fatty acids influence their role in phospholipids and fats.
      • Name and identify the ester bonds between fatty acids and glycerol and the glycerol and phosphate.
      • Characterize the environmental changes necessary to allow recycling of intermediates in receptor mediated endocytosis.
      • Describe a set of criteria for selective transport of a given molecule to pass through a membrane channel.
      • Describe a typical source of energy (general and specific examples).
      • Describe how osmotic pressure is generated and what conditions are necessary to create high osmotic pressure in a cell.
      • Describe the difference between general endocytosis and protein transduction.
      • Describe the factors that affect simple diffusion
      • Describe the fate of a molecule taken into a cell by receptor mediate endocytosis.
      • Describe the fate of the material undergoing endocytosis.
      • Describe the general structural features of a membrane transport protein.
      • Describe the solute differences between isotonic, hypertonic and hypotonic solutions.
      • Describe the spontaneous direction of the movement of molecules
      • Describe the structural and chemical characteristics of a typical ‘facilitator’.
      • Describe why the process requires energy.
      • Disntiguish how receptor mediated endocytosis differs from protein transduction.
      • Distinguish between facilitated diffusion and active transport.
      • Distinguish between simple diffusion and facilitated diffusion.
      • Distinguish the mechanisms of uniports, symports and antiports.
      • Explain how receptor mediated endocytosis differs from phagocytosis.
      • Explain the affect of an isotonic, hypertonic and hypotonic solution on the shape of a cell.
      • Explain the difference between pinocytosis and phagocytosis.
      • Explain why the description of osmosis emphasizes the solvent hanges.
      • Expound on how the inside surface of the endocytic vesicle is the same as the outside surface of the cell and why that is important to the cell.

      Unit 4: Basis of Molecular Biology

      • Module 10: DNA Replication
        • Characterize the direction of DNA synthesis.
        • Describe one method of editing that takes place during DNA synthesis.
        • Describe the formation of the Open Complex at the origin of replication.
        • Describe the process of connecting the Okazaki fragments into a continuous strand of DNA.
        • Describe the results of semiconservative replication.
        • Differentiate the multiple origins of replication that are used to reduce the time of replication of Eukaryotic chromosomes.
        • Discuss how competitive binding is used in DNA sequencing using dideoxy-NTPs.
        • Distinguish the difference between continuous and discontinuous DNA synthesis.
        • Explain how the appropriate substrate for DNA polymerase at the replication fork is established.
        • Explain how the the length of DNA amplified during PCR is defined.
        • Explain the substrate requirements for DNA synthesis by DNA polymerase.
        • Expound on why Okazaki fragments are formed on the lagging strand.
        • Specify how telomerase uses the rules for DNA synthesis to overcome shortening of the chromosome.
        • Describe a post-transcriptional modification that takes place with each of the classes of transcription products.
        • Describe the difference between a eukaryotic and prokaryotic Operon
        • Describe the differences between the substrate requirements for DNA polymerase and RNA polymerase
        • Describe the process of RNA splicing including the splicesome, introns, exons and lariats.
        • Describe the role of the 5′-cap and the 3′-polyA tail in the functioning of mRNA.
        • Describe the similarities between the functioning of DNA plymerase and RNA polymerase
        • Describe the steps in the process of transcription (RNA synthesis) starting with RNA polymerase binding to the promoter and ending with the release of polymerase from the terminator
        • Describe where the information (signal) for splicing is and why it might lead to alternative splicing.
        • Explain the difference between a weak and a strong promoter including the basis for the difference in “strength” of the promoter
        • Name the products of transcription and differentiate each from the others
        • Define the genetic code.
        • Define the role of each RNA molecule used in translation.
        • Describe the process of translation as a step-wiseprocess.
        • Describe what post-transcriptional modification must take place beforetranslation.
        • Distinguish between prokaryotic and eukaryotictranslation.
        • Correctly draw the hydrogen bonding between DNA and RNA bases.
        • Correctly identify and specifically name all of the nucleotides.
        • Define which helix type describes DNA and RNA.
        • Describe 3 common structural characteristics of DNA/RNA polymer backbones.
        • Describe the criteria for determining the most stable structure between two DNA molecules, two RNA molecules, between a DNA and a RNA molecule.
        • Describe the difference and identify the difference between a nucleotide and a nuceloside.
        • Describe the hydrogen bonding that exists between complimentary base pairs in DNA and RNA.
        • Describe the major characteristics of the B-DNA double helix
        • Describe the structural differences between the A-helix and B-helix.
        • Describe why AT and AU base pairs are weaker than GC base pairs.
        • Describe why purines are always paired with pyrimidines to form the helix structures of DNA and RNA.
        • Explain the major difference between the DNA and RNA backbone structures.
        • Give two examples of bioselectivity in the formation of the RNA or DNA backbone.
        • Identify a phosphodiester bond.
        • Identify correct base pairing between DNA and RNA bases.
        • Identify the difference between a purine and pyrimidine.
        • Identify the structure of each of the nitrogenous bases: A, T, G, C,U.
        • Identify which bases are incorporated into DNA and RNA.
        • Module 13: Pathways
          • Describe a linear, branched, and circular pathway.
          • Describe the common features of metabolic pathways.
          • Describe the major differences between a competitive and uncompetitive inhibitor.
          • Distinguish regulation by non-covalent and covalent modification of enzymes.
          • Explain activation of enzymes by allosteric compounds as a method of regulation.
          • State the major differences between catabolic and anabolic pathways.
          • Calculate the Gibbs free energy change, given the state of the system and the standard energy changes.
          • Describe how a pathway with a positive Gibbs free energy can be reversed by coupling to an energy releasing reaction.
          • Describe the direction of electron transfer in oxidation/reduction reactions.
          • Determine the spontaneous direction of a reaction from the Gibbs free energy.
          • Explain how to balance redox reactions.
          • Explain the difference between direct and indirect coupling.
          • Explain the major energy storage methods in metabolism – phosphorylated compounds, redox carriers, and proton gradient.
          • Explain the relationship between the equilibrium point of a system and the difference in standard energies.
          • Identify and describe the source of “high-energy” phosphate bonds in ATP.
          • Specify the difference between standard energy and Gibbs free energy.
          • State the name of two common organic electron carriers and show familiarity with changes in the structure that occurs on oxidation/reduction.
          • Tell how the energy stored in a thioester can be used for ATP synthesis or organic addition reactions.
          • Describe the reactions catalyzed by dehydrogenases, hydratases, isomerases, and synthetases.
          • Explain the difference between a kinase and a phosphatase
          • Define glycolysis and identify its celluar location.
          • Describe anaerobic metabolism and how it effects glycolysis.
          • Describe how energy released by oxidation is stored.
          • Distinguish how direct and indirect coupling are used to make glycolysis spontaneous.
          • Explain what happens when glucose is metabolized through glycolysis.
          • Describe how glycolysis connects to the TCA cycle and where the TCA cycle occurs.
          • Describe how intermediates in the TCA cycle are used to synthesize a wide range of compounds.
          • Explain where CO2 is released.
          • Expound on where, and in what form, the energy released by the TCA cycle is stored.
          • Explain ATP synthase and the effects of allosteric changes during proton translocation.
          • Explain the role of the four complexes, coenzyme Q, and cytochrome C in electron transport.
          • Explain what happens when electrons transport through complexes I, III, and IV.
          • Identify the pathway of the electrons from FADH2 to oxygen resulting in the formation of water.
          • Identify the pathway of the electrons from NADH to oxygen resulting in the formation of water.
          • Predict whether the free energy stored in the non-equilibrium hydrogen ion gradient is sufficient to sythesize ATP from the transport of 3 protons.
          • Describe how glycolysis and gluconeogenesis are coordinately regulated by sensing energy levels in the cell.
          • Describe how select amino acids enter the oxidative pathways.
          • Describe indirect coupling in glycogen synthesis and how glycogen synthase is controlled by protein phosphorylation.
          • Describe receptor mediated signal transduction and explain the role of G-proteins and adenyl cyclase.
          • Explain how glucose can be synthesized from pyruvate.
          • Explain how glycogen degradation by glycogen phosphorylase is controlled by protein phosphorylation.
          • Explain how hormone controlled phosphorylation of enzymes affect fructose 2,6 phosphate (F-26-P) levels.
          • Explain how the disaccharides sucrose and lactose enter glycolysis.
          • Explain the physiological role of the hormones epinephrine, glucagon, and insulin.
          • Explain the role of the protein kinases and phosphatases in regulating the enzyme function.
          • Express how glycogen and glucose metabolism in the liver effects the glucose demand of the organism and the liver cell.
          • Identify the role of phosphofructose kinase and fructose-1,6-bisphosphatase in gluconeogenesis pathways.
          • Indicate the number of steps in glycolysis that are too energetically unfavorable to reverse in gluconeogenesis and describe how the steps are reversed.
          • Recognize the structure of glycogen.
          • Specify how fats (triglycerides) are metabolized by fatty acid oxidation.
          • Specify the number of steps in glycolysis with Gibbs free energies that are close to zero and can be reversed in gluconeogenesis.
          • Summarize how fructose 2,6, phosphate levels regulate glycolysis and gluconeogenesis.
          • Tell how carbons atoms from the excess consumption of any dietary source can be incorporated into fats.

          Modern Biology

          Textbook Description:
          This free online textbook, Modern Biology, covers topics found in the fields of cellular biology, molecular biology, biochemistry, and genetics. This intro-level text provides the background biology students will need for advanced biology classes.

          Autor: OLI
          Subjects: Biology, Health Sciences & Medical
          Schlüsselwörter: Biology, Health Sciences, Medical
          Download URL: http://oli.web.cmu.edu/openlearning/forstudents/freecourses/biology

          Introduction to Developmental Biology

          Textbook Title: Introduction to Developmental Biology Textbook Description: Introduction to Developmental Biology Textbook covering a wide range of introductory college…

          Artificial Neural Networks: Biomedical Applications

          Textbook Title: Artificial Neural Networks: Methodological Advances and Biomedical Applications Textbook Description: This free online etextbook provides recent advances of…

          Textbook of Modern Toxicology

          Textbook Title: Textbook of Modern Toxicology Textbook Description: Textbook of Modern Toxicology is a unique resource that provides both students…

          College Physics for Students of Biology and Chemistry

          Textbook Title: College Physics for Students of Biology and Chemistry Textbook Description: College Physics for Students of Biology and Chemistry…

          Review of Clinical and Functional Neuroscience

          Textbook Title: Review of Clinical and Functional Neuroscience Textbook Description: This is a review text published by Dartmouth Medical School,…

          The Structures of Life

          Textbook Title: The Structures of Life Textbook Description: This free online textbook reviews how structural biology provides insight into health…

          Advances in the Neuroscience of Addiction

          Textbook Title: Advances in the Neuroscience of Addiction Textbook Description: This free online etextbook focuses on understanding the phenomenon of…

          The Chemistry of Plant Constituents

          Textbook Title: The Chemistry of Plant Constituents Textbook Description: This free online etextbook provides an overview of the chemistry of…

          Recent News.

          Find college financial aid information from our friends at CollegeWhale.com. Find easy scholarships and get student loan information.

          Find tips, articles, and answers to your etextbook questions on our TextBookGo Blog.

          Cheap Etextbooks For College What is the best place to download the cheapest textbooks for.

          Verbinden.

          Connect with others in our TextBookGo Social Network. Ask eTextbook questions, find answers, and share digital textbook advice with other students!

          Sign up for a free TextbookGo account to search and save your free etextbook selections. All textbooks are 100% free and ready to download.

          Abonnieren.

          Subscribe to TextBookGo.com to receive updates and notifications when new free etextbooks become available for download to your ipad or android tablet device.

          Subscribe to our RSS Feed, follow us on Twitter, or join us on Facebook for eTextbook news, and to stay up-to-date on our new free eTextbook listings.


          The 10 Best Biology Books Of 2017

          Whether you are giving gifts to others or to yourself this holiday season, this list of the best popular science books of 2017 in biology -- evolution and ecology combined with zoology and a plethora of other disciplines -- is a great place to start reading and gifting

          Best Biology Books of 2017. Composite by Bob O'Hara.

          Truly, 2017 is The Big Year for wonderful popular science books about biology. It’s taken me one agonizing week to narrow down my choices for the best biology books of 2017 into a stack that can be purchased and carried home and read. This list could easily have been three times longer, and I still would not have exhausted my choices for this year’s most faboo biology books. Despite the fact that you can hardly make the wrong choice when purchasing a 2017 book that focuses on some aspect of biology, here’s the list of books that I think are the best.

          How to Tame a Fox (and Build a Dog): Visionary Scientists and a Siberian Tale of Jump-Started Evolution by Lee Alan Dugatkin and Lyudmila Trut (University of Chicago Press, 2017 Amazon US / Amazon UK)

          Wie schnell can evolutionary changes occur? One useful way to examine this question is by studying the domestication process itself. In this amazing book, we learn about the famous experiment to domesticate silver foxes that has been ongoing in Russia for more than 60 years. The authors interweave the turbulent times of Soviet-era anti-evolution science, Lysenkoism, with more recent Russian history and biography, especially of the late Dimitri Belyaev, who started this experiment. There’s plenty of fascinating science here, too: how selectively breeding for tameness unintentionally changed the appearances of these foxes how hormone function changes as the result of domestication, and how this, in turn, influences and changes behavior and what genetic mapping reveals about where genetic changes occurred on the silver fox’s 17 pairs of chromosomes -- a more straightforward process compared to studying the domestication process in dogs, which have more than twice that number of chromosomes. In addition to the science that underlies this long-term experiment, the book includes charming anecdotes about individual foxes. This beautifully-written book reads like a novel -- a hard-to-put-down novel. It includes lots of lovely color photographs of foxes and their puppies, which are really danged cute. This book will appeal to dog (and fox) lovers, but also to anyone who wants a clearer understanding of evolution and genetics and the domestication process, of how politics affect science, how science itself has evolved with the appearance of new, more powerful technologies, and of course, how two dedicated and courageous individuals can change the world. If you read only two biology books this year, this is one of those two that you simply must read.

          The Evolution of Beauty: How Darwin’s Forgotten Theory of Mate Choice Shapes the Animal World -- And Us by Richard O. Prum (Doubleday Books, 2017 Amazon US / Amazon UK)

          This timely and provocative book examines animal behavior, sexual behavior, and feminism, and thus, for those reasons alone, I could write pages about how fascinating it is. Ornithologist and author, Richard Prum, begins by documenting the scientific evidence that supports Darwin’s overlooked theory of sexual selection, which results from individual females choosing their mates. We meet a wide variety of bird species with impressive courtship displays and fabulous ornaments: moonwalking Red-capped Manakins who are the Michael Jacksons of the bird world Club-winged Manakins who sing with their wings and the Peacock, which is famous for its extravagant train of iridescent feathers, just to name a few. After rigorously establishing the scientific framework that documents how female birds have created the flamboyant males of their species by selectively choosing who to mate with, Professor Prum then investigates how sexual selection applies to primates. Although these chapters are more speculative, this is where the ideas become even more compelling. (Well, for those who don’t appreciate birds.) Particularly interesting are the discussions about why human males have such large penises compared to our closest relatives: chimpanzees and gorillas. This meticulously researched and gripping book will appeal to everyone, and I do mean everyone: the evolution of duck penises and human penises combined with cultural evolution and the power of female choice will change how you think about why human society and religion are the way they are. There are more than enough ideas and information in this carefully argued book to spark viele interesting discussions with your friends and drinking pals. If you read only two biology books this year, this should be one of your two essential reads.

          The Evolution of Beauty was chosen as a “Best Book of the Year” by the New York Times Book Review, The Wall Street Journal, und Smithsonian.

          Monarchs and Milkweed: A Migrating Butterfly, a Poisonous Plant, and Their Remarkable Story of Coevolution by Anurag Agrawal (Princeton University Press, 2017 Amazon US / Amazon UK)

          This readable book provides a fascinating review of historical and current research into co-evolution by detailing the special relationship between America’s iconic migratory butterfly, the Monarch, and its host plant, the toxic Milkweed. In this book, the author, ecologist and evolutionary biologist, Anurag Agrawal, traces the life of a Monarch butterfly from an egg to a milkweed-chomping caterpillar, to a chrysalis undergoing that developmental alchemy known as metamorphosis, and finally, transformation into the migratory adult. The author recounts the classic evolutionary battle between the Milkweed, which evolved toxins to prevent their leaves being eaten, and the Monarch butterfly, which developed the ability to capture and concentrate Milkweed toxins in their bodies for protection from their own predators (usually birds). Professor Agrawal discusses Monarch butterfly conservation efforts and includes his own ideas about the reasons for the recent decline of Monarch butterfly populations. Written in clear and accessible prose, this lavishly illustrated and authoritative book is targeted to the nonspecialist and will be especially enjoyed by fans of butterflies and other insects. One caveat: don’t get the Kindle version.

          Improbable Destinies: How Predictable is Evolution? by Jonathan Losos (Allen Lane, 2017 Amazon US / Amazon UK)

          One long-standing debate in science is whether evolution follows a predictable course. On one side of the argument stood the late, great, Stephen Jay Gould, who claimed that if “the tape of life” on Earth was re-run, it would look very different today. Small differences in circumstances can lead to large differences in evolutionary trajectories. On the other side of this argument is Simon Conway Morris amongst others, who point out that convergent evolution belies Gould’s assertion. Convergent evolution is where distinct species evolve similar traits to meet similar challenges in similar circumstances. Examples include wings and eyes. In this compelling book, evolutionary ecologist, Jonathan Losos, shares his many years of research into anole lizards on Caribbean islands, and other studies into guppies, foxes, field mice and a plethora of other species, which demonstrate just how rapid and predictable evolution can be. Written as a personal narrative of discovery, this charming book is as engaging and interesting as I imagine it would be to chat with the author over a few beers. I was especially fascinated by Losos’s discussions of the evolutionary predictions made, and how scientists test them, and determining how particular examples of convergent evolution came about. Professor Losos’s insights into how natural selection and evolution affect the evolution of disease-causing viruses and bacteria, and securing our food supply are especially timely and important. This book is a lucid and captivating exploration of evolution and of the scientific ideas and experiments that reveal how it works.

          Other Minds: The Octopus and the Evolution of Intelligent Life by Peter Godfrey-Smith (William Collins, 2017 Amazon US / Amazon UK)

          Where does consciousness come from? How do other animals experience consciousness? How do we distinguish between mind and action? In this fascinating book, we explore the origin and evolution of sentience, consciousness and intelligence in the animal kingdom, by highlighting the development of cognition and brains in cephalopods (mostly octopus and cuttlefish) and comparing that to what we know of mammals and birds. The book follows evolution of the brain from the beginning from mere clumps of cells that began living together, then developing the capacity to sense, act and signal, and then becoming increasingly more complex. The author, Peter Godfrey-Smith, a Distinguished Professor of Philosophy at the City University of New York Graduate Center and Professor of History and Philosophy of Science at the University of Sydney, is also an avid diver who tells vivid stories of his underwater encounters with his fascinating subjects. Cephalopods’ unique neural structures allow them to experience the world very differently from how birds and mammals and, as Godfrey-Smith notes, studying cephalopods is probably as close as we will come to examining an alien mind. Throughout the book, Godfrey-Smith poses intriguing philosophical and scientific questions about the the nature of these animals’ awareness and describes some of his many delightful and eye-opening encounters with octopus and cuttlefish whilst diving. He also discusses how captive octopuses are no less clever than their wild counterparts, and reportedly perform all sorts of amazing intellectual feats: they can identify individual keepers sneak into neighboring tanks for food turn off lights with well-aimed jets of water and of course, escape. This engaging book provides a captivating glimpse into the philosophy and process underlying scientific inquiry and will change how you think about how other animals see and experience the world.

          Other Minds was chosen as a Top Ten Science Book by Verlage wöchentlich and was a New York Times Book Review Editors’ Choice, and was shortlisted by the Royal Society Insight Investment Popular Science Books of 2017.

          The Lost Species: Great Expeditions in the Collections of Natural History Museums by Christopher Kemp (University of Chicago Press, 2017 Amazon US / Amazon UK)

          I love reading about expeditions to exotic, faraway places, in search of species that are new to science. But not all species require such expensive and dangerous quests: every year, at least a few new species are discovered in the storage cabinets of natural history museums. In this book, molecular biologist and writer, Christopher Kemp, shares the stories of some of these rare specimens lurking in museum drawers or jars for decades, or even longer than a century, before an observant scientist realizes that she is looking at something new. In this book, we meet mislabeled landsnails king crabs collected in 1906 an unknown rove beetle collected by Darwin himself and the adorable, fluffy olinguito. We also learn that, tragically, some species have been overlooked for so long that they have disappeared before we even knew they were there. As Kemp showcases these inspiring discoveries, you’ll find yourself wondering what undiscovered treasures can be found in your local natural history museum. Clearly there is plenty of unknown biodiversity: currently, only 2 million species have been named out of the estimated 10 million that are thought to be out there (some credible estimates go as high as 30 million unnamed species), but I was amazed to learn that as many as halb of all museum specimens are misidentified. Yeow! Clearly, there’s a lot of taxonomic and systematic work to be done. This engaging book is a compelling argument for the overall value of natural history museums, and for the importance of studying these collections.

          Emerald Labyrinth: A Scientist's Adventures in the Jungles of the Congo by Eli Greenbaum (University Press of New England, 2017 Amazon US / Amazon UK)

          A typical day at work is rather predictable for most of us, but not so for herpetologist and evolutionary geneticist, Eli Greenbaum. In his dedication to discover and study snakes, lizards, and frogs, this daring scientist goes into the field in one of the most dangerous and remote places on Earth, the Democratic Republic of the Congo (DRC). He braves venom-spitting cobras, wild mountain gorillas and elephants, and teenaged rebels packing AK-47s, multiple infections with malaria and typhoid fever, and poisoning by a swarm of angry ants. Meticulously researched, fast-paced and beautifully illustrated with lots of photographs, this book seamlessly blends scientific discovery, memoir and travelogue with the historical context of the DRC’s almost legendary corruption. You may not be able to put down this inspirational page-turner until you’ve finished it.

          Resurrecting the Shark: A Scientific Obsession and the Mavericks Who Solved the Mystery of a 270-Million-Year-Old Fossil by Susan Ewing (Pegasus Books, 2017 Amazon US / Amazon UK)

          I still remember the astonishment I felt when I first saw I saw part of a fossil jaw of a Helicoprion, the “buzz saw shark”, at the Smithsonian. This large predator was the size of a modern great white shark, and it chomped its way through the world’s seas for roughly ten million years, until it went extinct just before the great mass extinction at the end of the Permian period. How the heck does that spiralled jaw, armed with hundreds of protruding razor sharp teeth, fit into a functional jaw? I wondered. I wasn’t the first one intrigued by this fossil: the Helicoprion lower jaw, with its distinctive whorl, has mystified amateurs and experts alike for more than a century and spawned a plethora of questions. How many spirals did each animal have? Were these spirals located in its mouth as either jaws or teeth, or were they on its tail or fins? If this whorl was in its mouth, was it located on the upper or lower jaw, in the front or back of the mouth? Was this whorl one tooth with multiple protruding stabby bits, or did it comprise many stabby teeth embedded in a jaw? How much force did a bite have? So viele Fragen! This absorbing book by journalist and writer, Susan Ewing, tells the exciting story of how two passionate paleo-shark enthusiasts -- one, an artist in Alaska, and the other, an Iraq war veteran -- met and joined forces to use the scientific process and cutting-edge technologies to pursue their passion to finally understand the enigmatic Helicoprion. The book is also well-illustrated with 24 pages of photographs and paintings of the fossils, reconstructions, and of the scientists. Ewing also shares lots of shark lore and painstakingly documents how paleontology worked in the past and how it has been revolutionized by state-of-the-art computer scanning and modeling technologies, combined with interdisciplinary approaches. This wonderful book will appeal to those who enjoy reading about the history of science, who love paleontology, and sharks, and especially to those who enjoy reading a good mystery.

          Darwin's Unfinished Symphony: How Culture Made the Human Mind by Kevin N. Laland (Princeton University Press, 2017 Amazon US / Amazon UK)

          How did the human mind -- and the uniquely human ability to devise and transmit culture -- evolve from its roots in animal behavior? Darwin’s Unfinished Symphony presents an interesting new idea for human cognitive evolution. This compelling and readable book discusses how human culture is not just the result of evolution -- it is also the key driving force behind that process in humans. Behavioural and evolutionary biologist, Kevin Laland shows how learned and socially transmitted activities of our ancestors shaped our intellectual abilities through accelerating cycles of evolutionary feedback. Drawing on his own research, Professor Laland explains how animals imitate, innovate, and have remarkable traditions of their own. But, as Professor Laland argues, the characteristics that make humans unique -- our intelligence, language, teaching, and cooperation -- differ from other animals’ because they are not adaptive responses to predators, disease, or other external conditions. Rather, they result from our culture, and thus, humans are creatures of our own making. Although Professor Laland's ideas may not ultimately be correct, these thought-provoking ideas are firmly based in painstaking fieldwork and key experiments that led to this new understanding of how culture transformed human evolution, and thus, are a good place to start further investigations. This engaging book will appeal to people who wish to understand human nature and civilization, whether philosophers, scientists and those with a curious mind.

          Bring Back the King: The New Science of De-extinction by Helen Pilcher (Bloomsbury Sigma, 2017 Amazon US / Amazon UK)

          If you could bring back to life a person or animal, what would you choose? In this amusing and educational book, science writer and comedian, Helen Pilcher shares her own choices from eras past, including the King of the Dinosaurs, Tyrannosaurus rex, and the King of Rock 'n' Roll, Elvis Presley. From dinosaurs to dodos and Neanderthals, this witty book reveals how the rapidly growing field of DNA science is being used to help resurrect individual animals and even entire species. Pilcher describes current initiatives and future plans to restore deceased species, and assesses the ramifications of how these creatures might fare today. Could a pet dinosaur be trained to roll over? Would Neanderthals enjoy opera? Could a returning dodo seek vengeance upon humanity? She asks. Pilcher also asks my favorite question when faced with de-extinction: “just because we can, does it mean we should?” and explores issues relating to species that would needed for cloning efforts and the effects introducing new species would have on current habitats. Blending the very latest de-extinction technology with cloning, and hard-core popular science with levity, this charming book will generate a lot of thoughtful discussion and a chuckle or two, and will be especially enjoyed by younger readers and non-specialists.


          Monitoring Animal Populations and their Habitats: A Practitioner's Guide

          Contributors: McComb, Zuckerberg, Vesely, and Jordan

          Publisher: Oregon State University

          We designed this book to offer a comprehensive overview of the monitoring process, from start to finish. Although there are books that deal with sampling design and the quantitative analysis of population data, there are few that provide practical advice covering the entire evolution of a monitoring plan from incorporating stakeholder input to data collection to data management and analysis to reporting. This book strives to present an overview of this process. We also acknowledge that any such effort tends to reflect the interests and expertise of the authors, and as such, there is a distinct emphasis on monitoring vertebrate populations and upland habitats. Although many of our examples tend to focus on bird populations and forested habitats, we have made an attempt to cover other taxa and habitat types as well, and many of the recommendations and suggestions that we present are applicable to a diversity of monitoring programs.


          Schau das Video: Moderne Literatur-Epochen. Gegenwartsliteratur erklärt - Impression-, Dada-, Symbol-, Surrealismus (Januar 2023).